Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

D(4) dopamine receptor (Drd4) Recombinant Protein | Drd4 recombinant protein

Recombinant Rat D (4) dopamine receptor (Drd4)

Gene Names
Drd4; D4RA
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
D(4) dopamine receptor (Drd4); Recombinant Rat D (4) dopamine receptor (Drd4); Drd4 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-387, Full length.
Sequence
MGNSSATGDGGLLAGRGPESLGTGTGLGGAGAAALVGGVLLIGMVLAGNSLVCVSVASERILQTPTNYFIVSLAAADLLLAVLVLPLFVYSEVQGGVWLLSPRLCDTLMAMDVMLCTASIFNLCAISVDRFVAVTVPLRYNQQGQCQLLLIAATWLLSAAVAAPVVCGLNDVPGRDPTVCCLEDRDYVVYSSICSFFLPCPLMLLLYWATFRGLRRWEAARHTKLHSRAPRRPSGPGPPVSDPTQGPLFSDCPPPSPSLRTSPTVSSRPESDLSQSPCSPGCLLPDAALAQPPAPSSRRKRGAKITGRERKAMRVLPVVVGAFLMCWTPFFVVHITRALCPACFVSPRLVSAVTWLGYVNSALNPIIYTIFNAEFRSVFRKTLRLRC
Sequence Length
387
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Drd4 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
41,294 Da
NCBI Official Full Name
D(4) dopamine receptor
NCBI Official Synonym Full Names
dopamine receptor D4
NCBI Official Symbol
Drd4
NCBI Official Synonym Symbols
D4RA
NCBI Protein Information
D(4) dopamine receptor
UniProt Protein Name
D(4) dopamine receptor
Protein Family
UniProt Gene Name
Drd4
UniProt Entry Name
DRD4_RAT

NCBI Description

may play a role in exploratory behavior and motor coordination; may be involved in lesion induced hyperactivity [RGD, Feb 2006]

Uniprot Description

DRD4: Dopamine receptor responsible for neuronal signaling in the mesolimbic system of the brain, an area of the brain that regulates emotion and complex behavior. Its activity is mediated by G proteins which inhibit adenylyl cyclase. Belongs to the G-protein coupled receptor 1 family.

Protein type: GPCR, family 1; Receptor, GPCR; Membrane protein, multi-pass; Membrane protein, integral

Cellular Component: axon; cell cortex; cell soma; cytoplasm; dendrite; dendritic spine; integral to plasma membrane; membrane; nerve terminal; plasma membrane; terminal button; vesicle membrane

Molecular Function: dopamine binding; dopamine D1 receptor-like receptor activity; dopamine D2 receptor-like receptor activity; dopamine receptor activity; drug binding; identical protein binding; protein binding; SH3 domain binding

Biological Process: activation of MAPK activity; adult locomotory behavior; arachidonic acid secretion; associative learning; behavioral fear response; behavioral response to cocaine; circadian rhythm; dopamine receptor signaling pathway; dopamine receptor, adenylate cyclase inhibiting pathway; fear response; locomotory behavior; negative regulation of adenylate cyclase activity; negative regulation of cAMP biosynthetic process; negative regulation of protein secretion; olfactory learning; photoperiodism; positive regulation of kinase activity; positive regulation of sodium:hydrogen antiporter activity; regulation of calcium-mediated signaling; regulation of circadian rhythm; regulation of dopamine metabolic process; regulation of inhibitory postsynaptic membrane potential; regulation of neurotransmitter secretion; regulation of synaptic transmission; response to amphetamine; response to steroid hormone stimulus; retina development in camera-type eye; short-term memory; synaptic transmission, dopaminergic

Research Articles on Drd4

Similar Products

Product Notes

The Drd4 drd4 (Catalog #AAA7013910) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-387, Full length. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Drd4 drd4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGNSSATGDG GLLAGRGPES LGTGTGLGGA GAAALVGGVL LIGMVLAGNS LVCVSVASER ILQTPTNYFI VSLAAADLLL AVLVLPLFVY SEVQGGVWLL SPRLCDTLMA MDVMLCTASI FNLCAISVDR FVAVTVPLRY NQQGQCQLLL IAATWLLSAA VAAPVVCGLN DVPGRDPTVC CLEDRDYVVY SSICSFFLPC PLMLLLYWAT FRGLRRWEAA RHTKLHSRAP RRPSGPGPPV SDPTQGPLFS DCPPPSPSLR TSPTVSSRPE SDLSQSPCSP GCLLPDAALA QPPAPSSRRK RGAKITGRER KAMRVLPVVV GAFLMCWTPF FVVHITRALC PACFVSPRLV SAVTWLGYVN SALNPIIYTI FNAEFRSVFR KTLRLRC . It is sometimes possible for the material contained within the vial of "D(4) dopamine receptor (Drd4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.