Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.67kD) usingMBS6008912.)

Mouse anti-Human GOLPH4 Monoclonal Antibody | anti-GOLPH4 antibody

GOLPH4 (Golgi Phosphoprotein 4, Golgi Integral Membrane Protein 4, GOLIM4, Golgi Integral Membrane Protein cis, GIMPC, Golgi-localized Phosphoprotein of 130kD, Golgi Phosphoprotein of 130kD, GPP130, P138) APC

Gene Names
GOLIM4; P138; GIMPC; GOLPH4; GPP130
Reactivity
Human
Applications
Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GOLPH4; Monoclonal Antibody; GOLPH4 (Golgi Phosphoprotein 4; Golgi Integral Membrane Protein 4; GOLIM4; Golgi Integral Membrane Protein cis; GIMPC; Golgi-localized Phosphoprotein of 130kD; Golgi Phosphoprotein of 130kD; GPP130; P138) APC; anti-GOLPH4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5E11
Specificity
Recognizes human GOLPH4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
696
Applicable Applications for anti-GOLPH4 antibody
FLISA, Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa473-568 from human GOLPH4 (NP_055311.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HQEQLRQQAHYDAMDNDIVQGAEDQGIQGEEGAYERDNQHQDEAEGDPGNRHEPREQGPREADPESEADRAAVEDINPADDPNNQGEDEFEEAEQV
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.67kD) usingMBS6008912.)

Western Blot (WB) (Western Blot detection against Immunogen (36.67kD) usingMBS6008912.)

Western Blot (WB)

(Western Blot analysis of GOLPH4 expression in HeLa usingMBS6008912.)

Western Blot (WB) (Western Blot analysis of GOLPH4 expression in HeLa usingMBS6008912.)

Testing Data

(Detection limit for recombinant GST tagged GOLPH4 is ~0.03ng/ml using MBS6008912 as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GOLPH4 is ~0.03ng/ml using MBS6008912 as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence to GOLPH4 on HeLa cell using MBS6008912 (10ug/ml).)

Immunofluorescence (IF) (Immunofluorescence to GOLPH4 on HeLa cell using MBS6008912 (10ug/ml).)
Related Product Information for anti-GOLPH4 antibody
The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi-resident protein. It may process proteins synthesized in the rough endoplasmic reticulum and assist in the transport of protein cargo through the Golgi apparatus.
Product Categories/Family for anti-GOLPH4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Golgi integral membrane protein 4 isoform 1
NCBI Official Synonym Full Names
golgi integral membrane protein 4
NCBI Official Symbol
GOLIM4
NCBI Official Synonym Symbols
P138; GIMPC; GOLPH4; GPP130
NCBI Protein Information
Golgi integral membrane protein 4
UniProt Protein Name
Golgi integral membrane protein 4
UniProt Gene Name
GOLIM4
UniProt Synonym Gene Names
GIMPC; GOLPH4; GPP130; GIMPc; Golgi phosphoprotein of 130 kDa

NCBI Description

The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi-resident protein. It may process proteins synthesized in the rough endoplasmic reticulum and assist in the transport of protein cargo through the Golgi apparatus. [provided by RefSeq, Jul 2008]

Uniprot Description

GOLPH4: Plays a role in endosome to Golgi protein trafficking; mediates protein transport along the late endosome-bypass pathway from the early endosome to the Golgi. Belongs to the GOLIM4 family.

Protein type: Membrane protein, integral; Vesicle

Chromosomal Location of Human Ortholog: 3q26.2

Cellular Component: cis-Golgi network; endocytic vesicle; endosome membrane; Golgi apparatus; Golgi lumen; Golgi membrane; integral component of membrane; membrane; transport vesicle

Research Articles on GOLPH4

Similar Products

Product Notes

The GOLPH4 golim4 (Catalog #AAA6136833) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GOLPH4 (Golgi Phosphoprotein 4, Golgi Integral Membrane Protein 4, GOLIM4, Golgi Integral Membrane Protein cis, GIMPC, Golgi-localized Phosphoprotein of 130kD, Golgi Phosphoprotein of 130kD, GPP130, P138) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GOLPH4 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GOLPH4 golim4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GOLPH4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.