Developmental Pluripotency Associated 5 Recombinant Protein | DPPA5 recombinant protein
Recombinant Human Developmental Pluripotency Associated 5
Gene Names
DPPA5; ESG1
Purity
Greater than 85.0% as determined by SDS-PAGE.
Synonyms
Developmental Pluripotency Associated 5; Recombinant Human Developmental Pluripotency Associated 5; DPPA5 Human; Developmental Pluripotency Associated 5 Human Recombinant; ESG1; Developmental pluripotency-associated 5 proteins; hDPPA5; Embryonal stem cell-specific gene 1 protein; ESG-1; DPPA5 recombinant protein
Host
E Coli
Purity/Purification
Greater than 85.0% as determined by SDS-PAGE.
Form/Format
DPPA5 protein solution (0.25mg/ml) containing 20mM Phosphate buffer (pH 8.0), and 10% glycerol.
Sterile Filtered clear solution.
Sterile Filtered clear solution.
Sequence
MGSSHHHHHH SSGLVPRGSH MGSMGTLPAR RHIPPWVKVP EDLKDPEVFQ VQTRLLKAIFGPDGSRIPYIEQVSKAMLEL KALESSDLTE VVVYGSYLYK LRTKWMLQSM AEWHRQRQER GMLKLAEAMNALELGPWMK
Sequence Length
116
Related Product Information for DPPA5 recombinant protein
Introduction: Developmental pluripotency-associated 5 proteins (DPPA5) is a 116 amino acid protein, which localizes to the cytoplasm and contains one KH domain. DPPA5 is expressed in embryonic germ (EG), primordial germ (PG) and embryonic stem (ES) cells. DPPA5 has an imperative role in the maintenance of ES cell pluripotency and may be essential for proper embryogenesis.
Description: DPPA5 Human Recombinant produced in E Coli is a single, non-glycosylated polypeptide chain containing 139 amino acids (1-116 a.a) and having a molecular mass of 15.9kDa.DPPA5 is fused to a 23 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.
Description: DPPA5 Human Recombinant produced in E Coli is a single, non-glycosylated polypeptide chain containing 139 amino acids (1-116 a.a) and having a molecular mass of 15.9kDa.DPPA5 is fused to a 23 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.
Product Categories/Family for DPPA5 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
13,498 Da
NCBI Official Full Name
developmental pluripotency-associated 5 protein
NCBI Official Synonym Full Names
developmental pluripotency associated 5
NCBI Official Symbol
DPPA5
NCBI Official Synonym Symbols
ESG1
NCBI Protein Information
developmental pluripotency-associated 5 protein
UniProt Protein Name
Developmental pluripotency-associated 5 protein
Protein Family
UniProt Gene Name
DPPA5
UniProt Synonym Gene Names
ESG1; hDPPA5; ESG-1
UniProt Entry Name
DPPA5_HUMAN
Uniprot Description
DPPA5: Involved in the maintenance of embryonic stem (ES) cell pluripotency. Dispensable for self-renewal of pluripotent ES cells and establishment of germ cells. Associates with specific target mRNAs. Belongs to the KHDC1 family.
Chromosomal Location of Human Ortholog: 6q13
Similar Products
Product Notes
The DPPA5 dppa5 (Catalog #AAA140771) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MGSSHHH HHH SSGLVPRGSH MGSMGT LPAR RHIPPWVKVP EDLKDPEVFQ VQTRLLKAIF GPDGSRIPYI EQVSKAMLEL KALESSDLTE VVVYGSYLYK LRTKWMLQSM AEWHRQRQER GMLKLAEAMN ALELGPWMK. It is sometimes possible for the material contained within the vial of "Developmental Pluripotency Associated 5, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
