Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Dipeptidyl peptidase 4 Recombinant Protein | Dpp4 recombinant protein

Dipeptidyl peptidase 4

Gene Names
Dpp4; CD26; DPPIV
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Dipeptidyl peptidase 4; Dpp4 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
638-767. partial protein;
Sequence
SMVLGSGSGVFKCGIAVAPVSRWEYYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQSAQISKALVDAGVDFQAMWYTDEDHGIASSTAHQHIYSHMSHFLQQCFSLR
Sequence Length
767
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Dpp4 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for Dpp4 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
88,089 Da
NCBI Official Full Name
dipeptidyl peptidase 4
NCBI Official Synonym Full Names
dipeptidylpeptidase 4
NCBI Official Symbol
Dpp4
NCBI Official Synonym Symbols
CD26; DPPIV
NCBI Protein Information
dipeptidyl peptidase 4
UniProt Protein Name
Dipeptidyl peptidase 4
Protein Family
UniProt Gene Name
Dpp4
UniProt Synonym Gene Names
Cd26; DPP IV
UniProt Entry Name
DPP4_RAT

NCBI Description

catalyzes the degradation of glucagon-like peptide-1 (Glp-1); involved in proteolysis and peptidolysis [RGD, Feb 2006]

Uniprot Description

DPP4: Cell surface glycoprotein receptor involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Acts as a positive regulator of T-cell coactivation, by binding at least ADA, CAV1, IGF2R, and PTPRC. Its binding to CAV1 and CARD11 induces T-cell proliferation and NF- kappa-B activation in a T-cell receptor/CD3-dependent manner. Its interaction with ADA also regulates lymphocyte-epithelial cell adhesion. In association with FAP is involved in the pericellular proteolysis of the extracellular matrix (ECM), the migration and invasion of endothelial cells into the ECM. May be involved in the promotion of lymphatic endothelial cells adhesion, migration and tube formation. When overexpressed, enhanced cell proliferation, a process inhibited by GPC3. Acts also as a serine exopeptidase with a dipeptidyl peptidase activity that regulates various physiological processes by cleaving peptides in the circulation, including many chemokines, mitogenic growth factors, neuropeptides and peptide hormones. Removes N-terminal dipeptides sequentially from polypeptides having unsubstituted N-termini provided that the penultimate residue is proline. Belongs to the peptidase S9B family. DPPIV subfamily.

Protein type: Cell adhesion; Cell surface; Vesicle; Cell cycle regulation; Protease; Endoplasmic reticulum; Membrane protein, integral; Motility/polarity/chemotaxis; EC 3.4.14.5

Cellular Component: apical plasma membrane; cell surface; endocytic vesicle; endoplasmic reticulum; focal adhesion; Golgi apparatus; intercellular canaliculus; lamellipodium; lysosomal membrane; membrane; plasma membrane

Molecular Function: collagen binding; dipeptidyl-peptidase activity; identical protein binding; peptide binding; protease binding; protein homodimerization activity; receptor binding; serine-type peptidase activity; viral receptor activity

Biological Process: behavioral fear response; endothelial cell migration; establishment of localization; positive regulation of cell proliferation; proteolysis; regulation of cell-cell adhesion mediated by integrin; regulation of T cell mediated immunity; response to hypoxia; T cell activation; T cell costimulation

Research Articles on Dpp4

Similar Products

Product Notes

The Dpp4 dpp4 (Catalog #AAA7042632) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 638-767. partial protein;. The amino acid sequence is listed below: SMVLGSGSGV FKCGIAVAPV SRWEYYDSVY TERYMGLPTP EDNLDHYRNS TVMSRAENFK QVEYLLIHGT ADDNVHFQQS AQISKALVDA GVDFQAMWYT DEDHGIASST AHQHIYSHMS HFLQQCFSLR. It is sometimes possible for the material contained within the vial of "Dipeptidyl peptidase 4, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.