Dolichol phosphate-mannose biosynthesis regulatory protein (DPM2) Recombinant Protein | DPM2 recombinant protein

Recombinant Human Dolichol phosphate-mannose biosynthesis regulatory protein (DPM2)

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Dolichol phosphate-mannose biosynthesis regulatory protein (DPM2); Recombinant Human Dolichol phosphate-mannose biosynthesis regulatory protein (DPM2); Recombinant Dolichol phosphate-mannose biosynthesis regulatory protein (DPM2); Dolichol phosphate-mannose biosynthesis regulatory protein; DPM2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-84
• Sequence: ATGTDQVVGLGLVAVSLIIFTYYTAWVILLPFIDSQHVIHKYFLPRAYAVAIPLAAGLLLLLFVGLFISYVMLKTKRVTKKAQ
• Sequence Length: 84

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

• NCBI GI #: 4503365
• NCBI GeneID: 8818
• NCBI Accession #: NP_003854.1
• NCBI GenBank Nucleotide #: NM_003863.3
• UniProt Accession #: O94777; Q5XKK9; Q6FGH3
• Molecular Weight: 9,312 Da
• NCBI Official Full Name: dolichol phosphate-mannose biosynthesis regulatory protein
• NCBI Official Synonym Full Names: dolichyl-phosphate mannosyltransferase polypeptide 2, regulatory subunit
• NCBI Official Symbol: DPM2
• NCBI Protein Information: dolichol phosphate-mannose biosynthesis regulatory protein; dolichol phosphate-mannose synthase 2
• UniProt Protein Name: Dolichol phosphate-mannose biosynthesis regulatory protein
• Protein Family: Dolichol phosphate-mannose biosynthesis regulatory protein
• UniProt Gene Name: DPM2
• UniProt Entry Name: DPM2_HUMAN

NCBI Description

Dolichol-phosphate mannose (Dol-P-Man) serves as a donor of mannosyl residues on the lumenal side of the endoplasmic reticulum (ER). Lack of Dol-P-Man results in defective surface expression of GPI-anchored proteins. Dol-P-Man is synthesized from GDP-mannose and dolichol-phosphate on the cytosolic side of the ER by the enzyme dolichyl-phosphate mannosyltransferase. The protein encoded by this gene is a hydrophobic protein that contains 2 predicted transmembrane domains and a putative ER localization signal near the C terminus. This protein associates with DPM1 in vivo and is required for the ER localization and stable expression of DPM1 and also enhances the binding of dolichol-phosphate to DPM1. [provided by RefSeq, Jul 2008]

Uniprot Description

DPM2: Regulates the biosynthesis of dolichol phosphate- mannose. Essential for the ER localization and stable expression of DPM1. Belongs to the DPM2 family.

Protein type: Membrane protein, multi-pass; Transferase; Membrane protein, integral; Endoplasmic reticulum

Chromosomal Location of Human Ortholog: 9q34.13

Cellular Component: glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex; endoplasmic reticulum membrane; perinuclear region of cytoplasm; integral to endoplasmic reticulum membrane

Molecular Function: protein binding; dolichyl-phosphate beta-D-mannosyltransferase activity; enzyme regulator activity

Biological Process: cellular protein metabolic process; protein amino acid O-linked mannosylation; dolichol-linked oligosaccharide biosynthetic process; regulation of catalytic activity; preassembly of GPI anchor in ER membrane; GPI anchor biosynthetic process; regulation of protein stability; dolichol metabolic process; C-terminal protein lipidation; protein amino acid N-linked glycosylation via asparagine; post-translational protein modification

Disease: Congenital Disorder Of Glycosylation, Type Iu