Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse COPS2 Monoclonal Antibody | anti-COPS2 antibody

COPS2 (COP9 Signalosome Complex Subunit 2, ALIEN, COP9 Constitutive Photomorphogenic Homolog Subunit 2, CSN2, JAB1-containing Signalosome Subunit 2, Signalosome Subunit 2, SGN2, Thyroid Receptor-interacting Protein 15, TR-interacting Protein 15, TRIP 15,

Gene Names
COPS2; CSN2; SGN2; ALIEN; TRIP15
Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
COPS2; Monoclonal Antibody; COPS2 (COP9 Signalosome Complex Subunit 2; ALIEN; COP9 Constitutive Photomorphogenic Homolog Subunit 2; CSN2; JAB1-containing Signalosome Subunit 2; Signalosome Subunit 2; SGN2; Thyroid Receptor-interacting Protein 15; TR-interacting Protein 15; TRIP 15; ; anti-COPS2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4B12
Specificity
Recognizes human COPS2. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-COPS2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa344-443 from COPS2 (NP_004227) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
REHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAVVSKLA
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(COPS2 monoclonal antibody Western Blot analysis of COPS2 expression in PC-12.)

Western Blot (WB) (COPS2 monoclonal antibody Western Blot analysis of COPS2 expression in PC-12.)

Western Blot (WB)

(COPS2 monoclonal antibody Western Blot analysis of COPS2 expression in Hela NE.)

Western Blot (WB) (COPS2 monoclonal antibody Western Blot analysis of COPS2 expression in Hela NE.)

Western Blot (WB)

(COPS2 monoclonal antibody Western Blot analysis of COPS2 expression in Raw 264.7.)

Western Blot (WB) (COPS2 monoclonal antibody Western Blot analysis of COPS2 expression in Raw 264.7.)
Related Product Information for anti-COPS2 antibody
Alien is a novel co-repressor that interacts with the thyroid hormone receptor in the absence of hormone. Alien is highly conserved between human and Drosophila and is specific for selected members of the nuclear hormone receptor superfamily.
Product Categories/Family for anti-COPS2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52,405 Da
NCBI Official Full Name
COP9 signalosome complex subunit 2 isoform 1
NCBI Official Synonym Full Names
COP9 signalosome subunit 2
NCBI Official Symbol
COPS2
NCBI Official Synonym Symbols
CSN2; SGN2; ALIEN; TRIP15
NCBI Protein Information
COP9 signalosome complex subunit 2; COP9 constitutive photomorphogenic homolog subunit 2; JAB1-containing signalosome subunit 2; TR-interacting protein 15; TRIP-15; alien homolog; thyroid receptor interacting protein 15; thyroid receptor-interacting prote
UniProt Protein Name
COP9 signalosome complex subunit 2
UniProt Gene Name
COPS2
UniProt Synonym Gene Names
CSN2; TRIP15; SGN2; Signalosome subunit 2; TR-interacting protein 15; TRIP-15
UniProt Entry Name
CSN2_HUMAN

Uniprot Description

COPS2: Essential component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN- dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. Involved in early stage of neuronal differentiation via its interaction with NIF3L1. Belongs to the CSN2 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription, coactivator/corepressor; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 15q21.2

Cellular Component: signalosome; cytoplasm

Molecular Function: protein binding; signal transducer activity; transcription corepressor activity

Biological Process: transcription from RNA polymerase II promoter; neuron differentiation; cell proliferation; cullin deneddylation; negative regulation of transcription from RNA polymerase II promoter; signal transduction

Similar Products

Product Notes

The COPS2 cops2 (Catalog #AAA6157221) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The COPS2 (COP9 Signalosome Complex Subunit 2, ALIEN, COP9 Constitutive Photomorphogenic Homolog Subunit 2, CSN2, JAB1-containing Signalosome Subunit 2, Signalosome Subunit 2, SGN2, Thyroid Receptor-interacting Protein 15, TR-interacting Protein 15, TRIP 15, reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's COPS2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the COPS2 cops2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "COPS2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.