Dedicator of cytokinesis protein 8 (Dock8) Recombinant Protein | Dock8 recombinant protein

Recombinant Mouse Dedicator of cytokinesis protein 8 (Dock8), partial

Cat. Num. AAA7110956

• Gene Names: Dock8; AI461977; 1200017A24Rik; 5830472H07Rik; A130095G14Rik
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Dedicator of cytokinesis protein 8 (Dock8); Recombinant Mouse Dedicator of cytokinesis protein 8 (Dock8); partial; Dock8 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 561-730. Partial
• Sequence: RNLLYVYPQRLNFASKLASARNITIKIQFMCGEDPSNAMPVIFGKSSGPEFLQEVYTAITYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGASGESLLGYSWLPILLNERLQTGSYCLPVALEKLPPNYSIHSAEKVPLQNPPIKWAEGHKGVFNIEVQAV

• Organism: Mus musculus (Mouse)
• Tag Information: N-terminal 6xHis-tagged
• Production Note: Special Offer: The E Coli, Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Coli, Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli, Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli, Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.; Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C.; The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-Page

Related Product Information for Dock8 recombinant protein

Potential guanine nucleotide exchange factor (GEF). GEF proteins activate some small GTPases by exchanging bound GDP for free GTP (By similarity). Is involved in NK cell cytotoxicity controlling polarization of microtubule-organizing center (MTOC), and possibly regulating CCDC88B-mediated lytic granule transport to MTOC during cell killing .

References

"Prediction of the coding sequences of mouse homologues of FLJ genes: the complete nucleotide sequences of 110 mouse FLJ-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries." Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Kitamura H., Nakagawa T., Nagase T., Ohara O., Koga H.DNA Res. 11:127-135 (2004)

NCBI and Uniprot Product Information

• NCBI GI #: 62241030
• NCBI GeneID: 76088
• NCBI Accession #: NP_083061.2
• NCBI GenBank Nucleotide #: NM_028785.3
• UniProt Accession #: Q8C147; Q6KAM7; Q6PIS0; Q7TMQ5; Q8CAP6; Q8K105; Q9DBQ2
• Molecular Weight: 21.2 kDa
• NCBI Official Full Name: dedicator of cytokinesis protein 8
• NCBI Official Synonym Full Names: dedicator of cytokinesis 8
• NCBI Official Symbol: Dock8
• NCBI Official Synonym Symbols: AI461977; 1200017A24Rik; 5830472H07Rik; A130095G14Rik
• NCBI Protein Information: dedicator of cytokinesis protein 8
• UniProt Protein Name: Dedicator of cytokinesis protein 8
• Protein Family: Dedicator of cytokinesis protein
• UniProt Gene Name: Dock8

Uniprot Description

Guanine nucleotide exchange factor (GEF) which specifically activates small GTPase CDC42 by exchanging bound GDP for free GTP (PubMed:28028151, PubMed:22461490). During immune responses, required for interstitial dendritic cell (DC) migration by locally activating CDC42 at the leading edge membrane of DC (PubMed:22461490, PubMed:25713392). Required for CD4+ T-cell migration in response to chemokine stimulation by promoting CDC42 activation at T cell leading edge membrane (PubMed:28028151). Is involved in NK cell cytotoxicity controlling polarization of microtubule-organizing center (MTOC), and possibly regulating CCDC88B-mediated lytic granule transport to MTOC during cell killing ().