Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

DnaJ homolog subfamily C member 7 (DNAJC7) Recombinant Protein | DNAJC7 recombinant protein

Recombinant Human DnaJ homolog subfamily C member 7 (DNAJC7)

Gene Names
DNAJC7; DJ11; DJC7; TPR2; TTC2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
DnaJ homolog subfamily C member 7 (DNAJC7); Recombinant Human DnaJ homolog subfamily C member 7 (DNAJC7); DNAJC7 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-494, Full length protein
Sequence
AAAAECDVVMAATEPELLDDQEAKREAETFKEQGNAYYAKKDYNEAYNYYTKAIDMCPKNASYYGNRAATLMMLGRFREALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALELDHKNAQAQQEFKNANAVMEYEKIAETDFEKRDFRKVVFCMDRALEFAPACHRFKILKAECLAMLGRYPEAQSVASDILRMDSTNADALYVRGLCLYYEDCIEKAVQFFVQALRMAPDHEKACIACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVNSKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYEKVYQTEKTKEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMHHPDRHSGASAEVQKEEEKKFKEVGEAFTILSDPKKKTRYDSGQDLDEEGMNMGDFDPNNIFKAFFGGPGGFSFEASGPGNFFFQFG
Sequence Length
493
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50,097 Da
NCBI Official Full Name
dnaJ homolog subfamily C member 7 isoform 2
NCBI Official Synonym Full Names
DnaJ heat shock protein family (Hsp40) member C7
NCBI Official Symbol
DNAJC7
NCBI Official Synonym Symbols
DJ11; DJC7; TPR2; TTC2
NCBI Protein Information
dnaJ homolog subfamily C member 7
UniProt Protein Name
DnaJ homolog subfamily C member 7
Protein Family
UniProt Gene Name
DNAJC7
UniProt Synonym Gene Names
TPR2; TTC2; TPR repeat protein 2

NCBI Description

This gene encodes a member of the DNAJ heat shock protein 40 family of proteins that is characterized by two N-terminal tetratricopeptide repeat domains and a C-terminal DNAJ domain. This protein binds the chaperone proteins heat shock proteins 70 and 90 in an ATP-dependent manner and may function as a co-chaperone. Pseudogenes of this gene are found on chromosomes 1 and 6. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Oct 2009]

Uniprot Description

Acts as co-chaperone regulating the molecular chaperones HSP70 and HSP90 in folding of steroid receptors, such as the glucocorticoid receptor and the progesterone receptor. Proposed to act as a recycling chaperone by facilitating the return of chaperone substrates to early stages of chaperoning if further folding is required. In vitro, induces ATP-independent dissociation of HSP90 but not of HSP70 from the chaperone-substrate complexes. Recruits NR1I3 to the cytoplasm ().

Research Articles on DNAJC7

Similar Products

Product Notes

The DNAJC7 dnajc7 (Catalog #AAA1285104) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-494, Full length protein. The amino acid sequence is listed below: AAAAECDVVM AATEPELLDD QEAKREAETF KEQGNAYYAK KDYNEAYNYY TKAIDMCPKN ASYYGNRAAT LMMLGRFREA LGDAQQSVRL DDSFVRGHLR EGKCHLSLGN AMAACRSFQR ALELDHKNAQ AQQEFKNANA VMEYEKIAET DFEKRDFRKV VFCMDRALEF APACHRFKIL KAECLAMLGR YPEAQSVASD ILRMDSTNAD ALYVRGLCLY YEDCIEKAVQ FFVQALRMAP DHEKACIACR NAKALKAKKE DGNKAFKEGN YKLAYELYTE ALGIDPNNIK TNAKLYCNRG TVNSKLRKLD DAIEDCTNAV KLDDTYIKAY LRRAQCYMDT EQYEEAVRDY EKVYQTEKTK EHKQLLKNAQ LELKKSKRKD YYKILGVDKN ASEDEIKKAY RKRALMHHPD RHSGASAEVQ KEEEKKFKEV GEAFTILSDP KKKTRYDSGQ DLDEEGMNMG DFDPNNIFKA FFGGPGGFSF EASGPGNFFF QFG. It is sometimes possible for the material contained within the vial of "DnaJ homolog subfamily C member 7 (DNAJC7), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.