Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Deleted in malignant brain tumors 1 protein (Dmbt1) Recombinant Protein | Dmbt1 recombinant protein

Recombinant Mouse Deleted in malignant brain tumors 1 protein (Dmbt1) , partial

Gene Names
Dmbt1; CRP; p80; Crpd; DBMT1; gp300; CRP-[a]; CRP-[b]
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Deleted in malignant brain tumors 1 protein (Dmbt1); Recombinant Mouse Deleted in malignant brain tumors 1 protein (Dmbt1); partial; Dmbt1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
186-424. Partial
Sequence
VRLVNGGDRCQGRVEILYQGSWGTVCDDSWDVSDANVVCRQLGCGWAVSAPGNAYFGQGQGPIVLDDVACGGYENYLWSCSHQGWLSHNCGHQEDAGVICSASQSSSPTPGWWNPGGTNNDVFYPTEQTTAGTDSGLAVRLVNGGDRCQGRVEILYQGSWGTVCDDSWDTNDANVVCRQLGCGWAVSAPGNAYFGPGSGSIVLDDVACTGHEDYLWRCSHRGWLSHNCGHHEDAGVICS
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
212,209 Da
NCBI Official Full Name
deleted in malignant brain tumors 1 protein isoform 1
NCBI Official Synonym Full Names
deleted in malignant brain tumors 1
NCBI Official Symbol
Dmbt1
NCBI Official Synonym Symbols
CRP; p80; Crpd; DBMT1; gp300; CRP-[a]; CRP-[b]
NCBI Protein Information
deleted in malignant brain tumors 1 protein
UniProt Protein Name
Deleted in malignant brain tumors 1 protein
UniProt Gene Name
Dmbt1
UniProt Synonym Gene Names
Crpd; gp300; Muclin

Uniprot Description

May play roles in mucosal defense system and cellular immune defense. May play a role in liver regeneration. May be an important factor in fate decision and differentiation of transit-amplifying ductular (oval) cells within the hepatic lineage. May function as a binding protein in saliva for the regulation of taste sensation. May play a role as an opsonin receptor for SFTPD and SPAR in macrophage tissues throughout the body, including epithelial cells lining the gastrointestinal tract (). Required for terminal differentiation of columnar epithelial cells during early embryogenesis. Displays a broad calcium-dependent binding spectrum against both Gram-positive and Gram-negative bacteria, suggesting a role in defense against bacterial pathogens. Binds to a range of poly-sulfated and poly-phosphorylated ligands which may explain its broad bacterial-binding specificity. Inhibits cytoinvasion of S.enterica. Associates with the actin cytoskeleton and is involved in its remodeling during regulated exocytosis. Interacts with pancreatic zymogens in a pH-dependent manner and may act as a Golgi cargo receptor in the regulated secretory pathway of the pancreatic acinar cell.

Research Articles on Dmbt1

Similar Products

Product Notes

The Dmbt1 dmbt1 (Catalog #AAA7086934) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 186-424. Partial. The amino acid sequence is listed below: VRLVNGGDRC QGRVEILYQG SWGTVCDDSW DVSDANVVCR QLGCGWAVSA PGNAYFGQGQ GPIVLDDVAC GGYENYLWSC SHQGWLSHNC GHQEDAGVIC SASQSSSPTP GWWNPGGTNN DVFYPTEQTT AGTDSGLAVR LVNGGDRCQG RVEILYQGSW GTVCDDSWDT NDANVVCRQL GCGWAVSAPG NAYFGPGSGS IVLDDVACTG HEDYLWRCSH RGWLSHNCGH HEDAGVICS . It is sometimes possible for the material contained within the vial of "Deleted in malignant brain tumors 1 protein (Dmbt1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.