Dynein light chain Tctex-type (Dlc90F) Recombinant Protein | Dlc90F recombinant protein
Recombinant Drosophila melanogaster Dynein light chain Tctex-type (Dlc90F)
Gene Names
Dlc90F; bs35g12.y1; CG12363; dlc90F; DmelCG12363; dtctex-1; l(3)04091; tctex; Tctex; tctex-1; Tctex-1; TcTex-1; Tctex1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Dynein light chain Tctex-type (Dlc90F); Recombinant Drosophila melanogaster Dynein light chain Tctex-type (Dlc90F); Dlc90F recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-111, Full length protein
Sequence
MDDSREESQFIVDDVSKTIKEAIETTIGGNAYQHDKVNNWTGQVVENCLTVLTKEQKPYKYIVTAMIMQKNGAGLHTASSCYWNNDTDGSCTVRWENKTMYCIVSVFGLAV
Sequence Length
111
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
12,479 Da
NCBI Official Full Name
dynein light chain 90F
NCBI Official Synonym Full Names
Dynein light chain 90F
NCBI Official Symbol
Dlc90F
NCBI Official Synonym Symbols
bs35g12.y1; CG12363; dlc90F; DmelCG12363; dtctex-1; l(3)04091; tctex; Tctex; tctex-1; Tctex-1; TcTex-1; Tctex1
NCBI Protein Information
CG12363 gene product from transcript CG12363-RA
UniProt Protein Name
Dynein light chain Tctex-type
UniProt Gene Name
Dlc90F
UniProt Synonym Gene Names
Tctex
Uniprot Description
Acts as one of several non-catalytic accessory components of the cytoplasmic dynein complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. Required for spermatid differentiation. Is not required for polarized transport in rhabdomere development and appears to be a non-essential component of the cytoplasmic dynein complex.
Research Articles on Dlc90F
Similar Products
Product Notes
The Dlc90F dlc90f (Catalog #AAA1409254) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-111, Full length protein. The amino acid sequence is listed below: MDDSREESQF IVDDVSKTIK EAIETTIGGN AYQHDKVNNW TGQVVENCLT VLTKEQKPYK YIVTAMIMQK NGAGLHTASS CYWNNDTDGS CTVRWENKTM YCIVSVFGLA V. It is sometimes possible for the material contained within the vial of "Dynein light chain Tctex-type (Dlc90F), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
