anti-Human, Rat MEFV Polyclonal Antibody | anti-MEFV antibody

Anti-MEFV Antibody

Cat. Num. AAA177735

• Gene Names: MEFV; FMF; MEF; TRIM20
• Reactivity: Human, Rat
• Applications: Western Blot
• Purity: Immunogen Affinity Purified
• Synonyms: MEFV; Polyclonal Antibody; Anti-MEFV Antibody; Pyrin; FMF; Marenostrin; Mediterranean fever; Mediterranean fever protein; MEF; Mefv; MEFV_HUMAN; TRIM20; anti-MEFV antibody

• Reactivity: Human, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 781

• Applicable Applications for anti-MEFV antibody: Western Blot (WB)
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human MEFV(5-39aa PSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSR), different from the related mouse sequence by eight amino acids, and from the related rat sequence by eleven amino acids.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- MEFV Picoband antibody, MBS177735, Western blottingAll lanes: Anti MEFV (MBS177735) at 0.5ug/mlLane 1: Rat Spleen Tissue Lysate at 50ugLane 2: Rat Lung Tissue Lysate at 50ugLane 3: HEPA Whole Cell Lysate at 40ugPredicted bind size: 86KDObserved bind size: 86KD )

Related Product Information for anti-MEFV antibody

Description: Rabbit IgG polyclonal antibody for Pyrin(MEFV) detection. Tested with WB in Human;Rat.

Background: MEFV (Mediterranean fever) is a human gene that provides instructions for making a protein called pyrin (also known as marenostrin). Pyrin is produced in certain white blood cells (neutrophils, eosinophils and monocytes) that play a role in inflammation and in fighting infection. Inside these white blood cells, pyrin is found with thecytoskeleton, the structural framework that helps to define the shape, size, and movement of a cell. Pyrin's protein structure also allows it to interact with other molecules involved in fighting infection and in the inflammatory response. Although pyrin's function is not fully understood, it likely assists in keeping the inflammation process under control. Research indicates that pyrin helps regulate inflammation by interacting with the cytoskeleton. And Pyrin may direct the migration of white blood cells to sites of inflammation and stop or slow the inflammatory response when it is no longer needed.

References

1. Dogan H, Akdemir F, Tasdemir S, Atis O, Diyarbakir E, Yildirim R, Emet M, Ikbal M (2014). "A novel insertion mutation identified in exon 10 of the MEFV gene associated with Familial Mediterranean Fever". BMC Medical Genetics 15 (1): 74. 2. Mansfield E, Chae JJ, Komarow HD, Brotz TM, Frucht DM, Aksentijevich I, Kastner DL (Aug 2001). "The familial Mediterranean fever protein, pyrin, associates with microtubules and colocalizes with actin filaments". Blood 98(3): 851-9.

NCBI and Uniprot Product Information

• NCBI GI #: 4557743
• NCBI GeneID: 4210
• NCBI Accession #: NP_000234.1
• NCBI GenBank Nucleotide #: NM_000243.2
• UniProt Accession #: O15553; Q3MJ84; Q96PN4; Q96PN5; D3DUC0; F5H0Q3
• Molecular Weight: 50,837 Da
• NCBI Official Full Name: pyrin isoform 1
• NCBI Official Synonym Full Names: Mediterranean fever
• NCBI Official Symbol: MEFV
• NCBI Official Synonym Symbols: FMF; MEF; TRIM20
• NCBI Protein Information: pyrin
• UniProt Protein Name: Pyrin
• Protein Family: Pyrin
• UniProt Gene Name: MEFV
• UniProt Entry Name: MEFV_HUMAN

NCBI Description

This gene encodes a protein, also known as pyrin or marenostrin, that is an important modulator of innate immunity. Mutations in this gene are associated with Mediterranean fever, a hereditary periodic fever syndrome. [provided by RefSeq, Jul 2008]

Uniprot Description

pyrin: Probably controls the inflammatory response in myelomonocytic cells at the level of the cytoskeleton organization. Defects in MEFV are the cause of familial Mediterranean fever autosomal recessive (ARFMF). ARFMF is an inherited disorder characterized by recurrent episodic fever, serosal inflammation and pain in the abdomen, chest or joints. ARFMF is frequently complicated by amyloidosis, which leads to renal failure and can be prophylactically treated with colchicine. ARFMF primarily affects ancestral ethnic groups living around the Mediterranean basin: North African Jews, Armenians, Arabs and Turks. The disease is also distributed in other populations including Greeks, Cypriots, Italians and Spanish, although at a lower prevalence. Defects in MEFV are the cause of familial Mediterranean fever autosomal dominant (ADFMF). ADFMF is characterized by periodic fever, serosal inflammation and pain in the abdomen, chest or joints as seen also in the autosomal recessive form of the disease. It is associated with renal amyloidosis and characterized by colchicine unresponsiveness. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: autophagic vacuole; cytoplasm; cytoplasmic vesicle; cytosol; lamellipodium; microtubule; microtubule associated complex; nucleus; ruffle

Molecular Function: actin binding; protein binding; zinc ion binding

Biological Process: inflammatory response; negative regulation of inflammatory response; negative regulation of interleukin-1 beta production; negative regulation of interleukin-12 production; positive regulation of autophagy

Disease: Familial Mediterranean Fever; Familial Mediterranean Fever, Autosomal Dominant