Probable ATP-dependent RNA helicase DHX36 (DHX36) Recombinant Protein | DHX36 recombinant protein

Recombinant Human Probable ATP-dependent RNA helicase DHX36 (DHX36) , partial

Cat. Num. AAA1410626

• Gene Names: DHX36; G4R1; RHAU; DDX36; MLEL1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Probable ATP-dependent RNA helicase DHX36 (DHX36); Recombinant Human Probable ATP-dependent RNA helicase DHX36 (DHX36); partial; DHX36 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 89-179aa; Partial
• Sequence: ERREEQIVQLLNSVQAKNDKESEAQISWFAPEDHGYGTEVSTKNTPCSENKLDIQEKKLINQEKKMFRIRNRSYIDRDSEYLLQENEPDGT

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for DHX36 recombinant protein

This gene is a member of the DEAH-box family of RNA-dependent NTPases which are named after the conserved amino acid sequence Asp-Glu-Ala-His in motif II. This protein has been shown to enhance the deadenylation and decay of mRNAs with 3 -UTR AU-rich elements (ARE-mRNA). The protein has also been shown to resolve into single strands the highly stable tetramolecular DNA configuration (G4) that can form spontaneously in guanine-rich regions of DNA. Alternative splicing results in multiple transcript variants encoding different isoforms.

NCBI and Uniprot Product Information

• NCBI GI #: 167830436
• NCBI GeneID: 170506
• NCBI Accession #: NP_001107869.1
• NCBI GenBank Nucleotide #: NM_001114397.1
• UniProt Accession #: Q9H2U1; Q70JU3; Q8IYE5; Q9P240; B2RB00
• Molecular Weight: 111,479 Da
• NCBI Official Full Name: ATP-dependent RNA helicase DHX36 isoform 2
• NCBI Official Synonym Full Names: DEAH-box helicase 36
• NCBI Official Symbol: DHX36
• NCBI Official Synonym Symbols: G4R1; RHAU; DDX36; MLEL1
• NCBI Protein Information: ATP-dependent RNA helicase DHX36
• UniProt Protein Name: ATP-dependent RNA helicase DHX36
• Protein Family: ATP-dependent RNA helicase
• UniProt Gene Name: DHX36
• UniProt Synonym Gene Names: DDX36; KIAA1488; MLEL1; RHAU; G4R1

NCBI Description

This gene is a member of the DEAH-box family of RNA-dependent NTPases which are named after the conserved amino acid sequence Asp-Glu-Ala-His in motif II. The protein encoded by this gene has been shown to enhance the deadenylation and decay of mRNAs with 3'-UTR AU-rich elements (ARE-mRNA). The protein has also been shown to resolve into single strands the highly stable tetramolecular DNA configuration (G4) that can form spontaneously in guanine-rich regions of DNA. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

Proposed to have a global role in regulating mRNA expression including transcriptional regulation and mRNA stability. Binds with high affinity to and resolves tetramolecular RNA and DNA quadruplex structures. Unwinds intramolecular quadruplexes derived from the ZIC1 and the MYC promoters. Binds to quadruplex structures in the promoters of YY1 and ALPL genes and regulates their expression. Binds to telomerase RNA template component (TERC) 5'-end (nucleotides 1-43) and unwinds an internal quadruplex formation in TERC 5'-end to promote P1 helix formation; the P1 helix acts as a template boundary ensuring accurate reverse transcription and is disrupted by quadruplex formation. May be involved in regulation of telomere length. Plays a role in degradation and deadenylation of mRNAs containing in their 3'-UTR the consensus ARE sequence element. May function in sex development and spermatogenesis. May play a role in ossification.