Beta-defensin 103 (DEFB103A) Recombinant Protein | DEFB103A recombinant protein
Recombinant Human Beta-defensin 103 (DEFB103A), partial
Gene Names
DEFB103A; BD-3; HBD3; HBP3; DEFB3; HBP-3; hBD-3; DEFB-3; DEFB103
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Beta-defensin 103 (DEFB103A); Recombinant Human Beta-defensin 103 (DEFB103A); partial; DEFB103A recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-67aa, Cytoplasmic domain
Sequence
GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK
Sequence Length
67
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for DEFB103A recombinant protein
Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 103B, which has broad spectrum antimicrobial activity and may play an important role in innate epithelial defense.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
7,697 Da
NCBI Official Full Name
beta-defensin 103
NCBI Official Synonym Full Names
defensin beta 103A
NCBI Official Symbol
DEFB103A
NCBI Official Synonym Symbols
BD-3; HBD3; HBP3; DEFB3; HBP-3; hBD-3; DEFB-3; DEFB103
NCBI Protein Information
beta-defensin 103
UniProt Protein Name
Beta-defensin 103
Protein Family
UniProt Gene Name
DEFB103A
UniProt Synonym Gene Names
BD3; DEFB103; DEFB3; BD-3; DEFB-3; HBD3; hBD-3
NCBI Description
Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 103, an antibiotic peptide which is induced by bacteria and interferon gamma, and which displays antimicrobial activity against S. aureus, S. pyogenes, P. aeruginosa, E. coli, and C. albicans. [provided by RefSeq, Oct 2014]
Uniprot Description
Exhibits antimicrobial activity against Gram-positive bacteria S.aureus and S.pyogenes, Gram-negative bacteria P.aeruginosa and E.coli and the yeast C.albicans. Kills multiresistant S.aureus and vancomycin-resistant E.faecium. No significant hemolytic activity was observed.
Research Articles on DEFB103A
Similar Products
Product Notes
The DEFB103A defb103a (Catalog #AAA954403) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-67aa, Cytoplasmic domain. The amino acid sequence is listed below: GIINTLQKYY CRVRGGRCAV LSCLPKEEQI GKCSTRGRKC CRRKK. It is sometimes possible for the material contained within the vial of "Beta-defensin 103 (DEFB103A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
