Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (74.4kD).)

Mouse anti-Human LILRA3 Monoclonal Antibody | anti-LILRA3 antibody

LILRA3 (ILT6, CD85e, Leukocyte Immunoglobulin-like Receptor Subfamily A Member 3, CD85 Antigen-like Family Member E, Immunoglobulin-like Transcript 6, ILT-6, Leukocyte Immunoglobulin-like Receptor 4, LIR-4, Monocyte Inhibitory Receptor HM43/HM31, LIR4) (A

Gene Names
LILRA3; HM31; HM43; ILT6; LIR4; CD85E; ILT-6; LIR-4
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LILRA3; Monoclonal Antibody; LILRA3 (ILT6; CD85e; Leukocyte Immunoglobulin-like Receptor Subfamily A Member 3; CD85 Antigen-like Family Member E; Immunoglobulin-like Transcript 6; ILT-6; Leukocyte Immunoglobulin-like Receptor 4; LIR-4; Monocyte Inhibitory Receptor HM43/HM31; LIR4) (A; anti-LILRA3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2E9
Specificity
Recognizes human LILRA3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-LILRA3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length recombinant protein corresponding to aa1-439 from human LILRA3 (AAH28208) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MTSILTVLICLGLSLDPRTHVQAGPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTVGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGE
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (74.4kD).)

Western Blot (WB) (Western Blot detection against Immunogen (74.4kD).)

Western Blot (WB)

(Western Blot analysis of LILRA3 expression in transfected 293T cell line using129092 Lane 1: LILRA3 transfected lysate (50.485kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of LILRA3 expression in transfected 293T cell line using129092 Lane 1: LILRA3 transfected lysate (50.485kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-LILRA3 antibody
ILT6, also known as CD85e, LIR4, and LILRA3, contains four Ig-like C2-type domains and is the only ILT family member that lacks a transmembrane and cytoplasmic domain. ILT proteins modulate immune responses through interactions with class I MHC molecules. Several polymorphisms of ILT6 have been described, and loss of ILT6 is associated with the development of multiple sclerosis. Human and chimpanzee ILT6 share 84% aa sequence identity. ILT6 orthologs have not been described in other species.
Product Categories/Family for anti-LILRA3 antibody
References
1. Low HZ, et al., TLR8 regulation of LILRA3 in monocytes is abrogated in human immunodeficiency virus infection and correlates to CD4 counts and virus loads. Retrovirology. 2016 Mar 12; 13(1):15. 2. An H, et al., Serum Leukocyte Immunoglobulin-Like Receptor A3 (LILRA3) Is Increased in Patients with Multiple Sclerosis and Is a Strong Independent Indicator of Disease Severity; 6.7kbp LILRA3 Gene Deletion Is Not Associated with Diseases Susceptibility. PLoS One. 2016 Feb 12; 11(2):e0149200. 3. An H, et al., Soluble LILRA3 promotes neurite outgrowth and synapses formation through high affinity interaction with Nogo 66. Cell Sci. 2016 Jan 29.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
49,187 Da
NCBI Official Full Name
Homo sapiens leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member 3, mRNA
NCBI Official Synonym Full Names
leukocyte immunoglobulin like receptor A3
NCBI Official Symbol
LILRA3
NCBI Official Synonym Symbols
HM31; HM43; ILT6; LIR4; CD85E; ILT-6; LIR-4
NCBI Protein Information
leukocyte immunoglobulin-like receptor subfamily A member 3

NCBI Description

This gene encodes a member of a family of immunoreceptors that are expressed predominantly in monocytes and B cells, and at lower levels in dendritic cells and natural killer cells. The encoded protein lacks the transmembrane region found in other members of this family. It acts as a soluble receptor for class I major histocompatibility complex (MHC) antigens. Alternatively spliced transcript variants encoding different isoforms have been found. This gene is located in a cluster of related genes on chromosome 19 and is polymorphic in human populations, with many individuals containing a deletion of this genomic region. [provided by RefSeq, Mar 2014]

Research Articles on LILRA3

Similar Products

Product Notes

The LILRA3 (Catalog #AAA6132103) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LILRA3 (ILT6, CD85e, Leukocyte Immunoglobulin-like Receptor Subfamily A Member 3, CD85 Antigen-like Family Member E, Immunoglobulin-like Transcript 6, ILT-6, Leukocyte Immunoglobulin-like Receptor 4, LIR-4, Monocyte Inhibitory Receptor HM43/HM31, LIR4) (A reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LILRA3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LILRA3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LILRA3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.