DNA damage-inducible transcript 3 protein (DDIT3) Recombinant Protein | DDIT3 recombinant protein

Recombinant Human DNA damage-inducible transcript 3 protein (DDIT3)

Cat. Num. AAA956482

• Gene Names: DDIT3; CHOP; CEBPZ; CHOP10; CHOP-10; GADD153; C/EBPzeta
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: DNA damage-inducible transcript 3 protein (DDIT3); Recombinant Human DNA damage-inducible transcript 3 protein (DDIT3); DDIT3 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-169, Full length protein
• Sequence: MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA
• Sequence Length: 169

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 304282225
• NCBI GeneID: 1649
• NCBI Accession #: NP_001181982.1
• NCBI GenBank Nucleotide #: NM_001195053.1
• UniProt Accession #: P35638; F8VS99
• Molecular Weight: 21,700 Da
• NCBI Official Full Name: DNA damage-inducible transcript 3 protein isoform 1
• NCBI Official Synonym Full Names: DNA damage inducible transcript 3
• NCBI Official Symbol: DDIT3
• NCBI Official Synonym Symbols: CHOP; CEBPZ; CHOP10; CHOP-10; GADD153; C/EBPzeta
• NCBI Protein Information: DNA damage-inducible transcript 3 protein
• UniProt Protein Name: DNA damage-inducible transcript 3 protein
• Protein Family: DNA damage-inducible transcript 3 protein
• UniProt Gene Name: DDIT3
• UniProt Synonym Gene Names: CHOP; CHOP10; GADD153; DDIT-3; CHOP; CHOP-10

NCBI Description

This gene encodes a member of the CCAAT/enhancer-binding protein (C/EBP) family of transcription factors. The protein functions as a dominant-negative inhibitor by forming heterodimers with other C/EBP members, such as C/EBP and LAP (liver activator protein), and preventing their DNA binding activity. The protein is implicated in adipogenesis and erythropoiesis, is activated by endoplasmic reticulum stress, and promotes apoptosis. Fusion of this gene and FUS on chromosome 16 or EWSR1 on chromosome 22 induced by translocation generates chimeric proteins in myxoid liposarcomas or Ewing sarcoma. Multiple alternatively spliced transcript variants encoding two isoforms with different length have been identified. [provided by RefSeq, Aug 2010]

Uniprot Description

Multifunctional transcription factor in ER stress response. Plays an essential role in the response to a wide variety of cell stresses and induces cell cycle arrest and apoptosis in response to ER stress. Plays a dual role both as an inhibitor of CCAAT/enhancer-binding protein (C/EBP) function and as an activator of other genes. Acts as a dominant-negative regulator of C/EBP-induced transcription: dimerizes with members of the C/EBP family, impairs their association with C/EBP binding sites in the promoter regions, and inhibits the expression of C/EBP regulated genes. Positively regulates the transcription of TRIB3, IL6, IL8, IL23, TNFRSF10B/DR5, PPP1R15A/GADD34, BBC3/PUMA, BCL2L11/BIM and ERO1L. Negatively regulates; expression of BCL2 and MYOD1, ATF4-dependent transcriptional activation of asparagine synthetase (ASNS), CEBPA-dependent transcriptional activation of hepcidin (HAMP) and CEBPB-mediated expression of peroxisome proliferator-activated receptor gamma (PPARG). Inhibits the canonical Wnt signaling pathway by binding to TCF7L2/TCF4, impairing its DNA-binding properties and repressing its transcriptional activity. Plays a regulatory role in the inflammatory response through the induction of caspase-11 (CASP4/CASP11) which induces the activation of caspase-1 (CASP1) and both these caspases increase the activation of pro-IL1B to mature IL1B which is involved in the inflammatory response.