SDS-PAGE
37 kDa salivary gland allergen Aed a 2 (D7) Recombinant Protein | D7 recombinant protein
Recombinant Aedes aegypti 37 kDa salivary gland allergen Aed a 2 (D7)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
37 kDa salivary gland allergen Aed a 2 (D7); Recombinant Aedes aegypti 37 kDa salivary gland allergen Aed a 2 (D7); 37 kDa salivary gland allergen Aed a 2; Protein D7; Allergen=; Aed a 2; D7 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
18-321. Full Length of Mature Protein
Sequence
STGPFDPEEMLFTFTRCMEDNLEDGPNRLPMLAKWKEWINEPVDSPATQCFGKCVLVRTGLYDPVAQKFDASVIQEQFKAYPSLGEKSKVEAYANAVQQLPSTNNDCAAVFKAYDPVHKAHKDTSKNLFHGNKELTKGLYEKLGKDIRQKKQSYFEFCENKYYPAGSDKRQQLCKIRQYTVLDDALFKEHTDCVMKGIRYITKNNELDAEEVKRDFMQVNKDTKALEKVLNDCKSKEPSNAGEKSWHYYKCLVESSVKDDFKEAFDYREVRSQIYAFNLPKKQVYSKPAVQSQVMEIDGKQCPQ
Species
Aedes aegypti (Yellowfever mosquito) (Culex aegypti)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Related Product Information for D7 recombinant protein
Thought to be involved in blood-feeding.
Product Categories/Family for D7 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
37.1 kDa
NCBI Official Full Name
D7 protein, putative
NCBI Official Symbol
AaeL_AAEL006424
NCBI Protein Information
D7 protein, putative
UniProt Protein Name
37 kDa salivary gland allergen Aed a 2
Protein Family
UniProt Gene Name
D7
UniProt Entry Name
ALL2_AEDAE
Uniprot Description
Thought to be involved in blood-feeding.
Research Articles on D7
Similar Products
Product Notes
The D7 d7 (Catalog #AAA1004740) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 18-321. Full Length of Mature Protein. The amino acid sequence is listed below: STGPFDPEEM LFTFTRCMED NLEDGPNRLP MLAKWKEWIN EPVDSPATQC FGKCVLVRTG LYDPVAQKFD ASVIQEQFKA YPSLGEKSKV EAYANAVQQL PSTNNDCAAV FKAYDPVHKA HKDTSKNLFH GNKELTKGLY EKLGKDIRQK KQSYFEFCEN KYYPAGSDKR QQLCKIRQYT VLDDALFKEH TDCVMKGIRY ITKNNELDAE EVKRDFMQVN KDTKALEKVL NDCKSKEPSN AGEKSWHYYK CLVESSVKDD FKEAFDYREV RSQIYAFNLP KKQVYSKPAV QSQVMEIDGK QCPQ . It is sometimes possible for the material contained within the vial of "37 kDa salivary gland allergen Aed a 2 (D7), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
