Sulfate transport system permease protein CysT (cysT) Recombinant Protein | Synpcc7942_1682 recombinant protein
Recombinant Synechococcus elongatus Sulfate transport system permease protein CysT (cysT)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Sulfate transport system permease protein CysT (cysT); Recombinant Synechococcus elongatus Sulfate transport system permease protein CysT (cysT); Recombinant Sulfate transport system permease protein CysT (cysT); Sulfate transport system permease protein CysT; Synpcc7942_1682 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-278
Sequence
MSLRLPSLSFTWLTRLSWSWRFTWVYLTLILFIPIIALFLKSASLPLGRIWELATQPVAVAAYEVTFGLSLAAAALNGVFGVIIAWVLTRYDFPGKKLFDSFIDLPFALPTAVAGLTLATVYSDKGWIGQFIAPFGVQIAFTRWGVLLAMVFISLPFVVRTVEPLLLELEVEAEEAAASLGASPSETFWRVILPPILPGVLAGVAQGFSRAVGEFGSVVIISGNLPFDDLIAPVLIFERLEQYDYAGATVIGSVLLLFSLVILFVINALQNWSSRYNG
Sequence Length
278
Species
Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30,438 Da
NCBI Official Full Name
sulfate transport system permease 2
NCBI Official Symbol
Synpcc7942_1682
NCBI Protein Information
sulfate transport system permease 2
UniProt Protein Name
Sulfate transport system permease protein CysT
UniProt Gene Name
cysT
UniProt Entry Name
CYST_SYNE7
Uniprot Description
Function: Part of the ABC transporter complex CysAWTP (TC 3.A.1.6.1) involved in sulfate/thiosulfate import. Probably responsible for the translocation of the substrate across the membrane
By similarity.
Subunit structure: The complex is composed of two ATP-binding proteins (CysA), two transmembrane proteins (CysT and CysW) and a solute-binding protein (CysP)
Probable.
Subcellular location: Cell inner membrane; Multi-pass membrane protein.
Induction: By sulfur deprivation.
Sequence similarities: Belongs to the binding-protein-dependent transport system permease family. CysTW subfamily.Contains 1 ABC transmembrane type-1 domain.
Similar Products
Product Notes
The Synpcc7942_1682 cyst (Catalog #AAA1076678) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-278. The amino acid sequence is listed below: MSLRLPSLSF TWLTRLSWSW RFTWVYLTLI LFIPIIALFL KSASLPLGRI WELATQPVAV AAYEVTFGLS LAAAALNGVF GVIIAWVLTR YDFPGKKLFD SFIDLPFALP TAVAGLTLAT VYSDKGWIGQ FIAPFGVQIA FTRWGVLLAM VFISLPFVVR TVEPLLLELE VEAEEAAASL GASPSETFWR VILPPILPGV LAGVAQGFSR AVGEFGSVVI ISGNLPFDDL IAPVLIFERL EQYDYAGATV IGSVLLLFSL VILFVINALQ NWSSRYNG. It is sometimes possible for the material contained within the vial of "Sulfate transport system permease protein CysT (cysT), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
