Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PTK2B Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Rabbit PTK2B Polyclonal Antibody | anti-PTK2B antibody

PTK2B antibody - C-terminal region

Gene Names
PTK2B; PKB; PTK; CAKB; FAK2; PYK2; CADTK; FADK2; RAFTK
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PTK2B; Polyclonal Antibody; PTK2B antibody - C-terminal region; anti-PTK2B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KSPLTPEKEVGYLEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMEL
Sequence Length
1009
Applicable Applications for anti-PTK2B antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human PTK2B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PTK2B Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-PTK2B Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-PTK2B antibody
This is a rabbit polyclonal antibody against PTK2B. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PTK2B encodes a cytoplasmic protein tyrosine kinase which is involved in calcium-induced regulation of ion channels and activation of the map kinase signaling pathway. The encoded protein may represent an important signaling intermediate between neuropeptide-activated receptors or neurotransmitters that increase calcium flux and the downstream signals that regulate neuronal activity. The encoded protein undergoes rapid tyrosine phosphorylation and activation in response to increases in the intracellular calcium concentration, nicotinic acetylcholine receptor activation, membrane depolarization, or protein kinase C activation. This protein has been shown to bind CRK-associated substrate, nephrocystin, GTPase regulator associated with FAK, and the SH2 domain of GRB2. The encoded protein is a member of the FAK subfamily of protein tyrosine kinases but lacks significant sequence similarity to kinases from other subfamilies.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
116kDa
NCBI Official Full Name
protein-tyrosine kinase 2-beta isoform a
NCBI Official Synonym Full Names
protein tyrosine kinase 2 beta
NCBI Official Symbol
PTK2B
NCBI Official Synonym Symbols
PKB; PTK; CAKB; FAK2; PYK2; CADTK; FADK2; RAFTK
NCBI Protein Information
protein-tyrosine kinase 2-beta
UniProt Protein Name
Protein-tyrosine kinase 2-beta
Protein Family
UniProt Gene Name
PTK2B
UniProt Synonym Gene Names
FAK2; PYK2; RAFTK; CADTK; CAK-beta; CAKB; FADK 2; RAFTK
UniProt Entry Name
FAK2_HUMAN

NCBI Description

This gene encodes a cytoplasmic protein tyrosine kinase which is involved in calcium-induced regulation of ion channels and activation of the map kinase signaling pathway. The encoded protein may represent an important signaling intermediate between neuropeptide-activated receptors or neurotransmitters that increase calcium flux and the downstream signals that regulate neuronal activity. The encoded protein undergoes rapid tyrosine phosphorylation and activation in response to increases in the intracellular calcium concentration, nicotinic acetylcholine receptor activation, membrane depolarization, or protein kinase C activation. This protein has been shown to bind CRK-associated substrate, nephrocystin, GTPase regulator associated with FAK, and the SH2 domain of GRB2. The encoded protein is a member of the FAK subfamily of protein tyrosine kinases but lacks significant sequence similarity to kinases from other subfamilies. Four transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

Pyk2: a nonreceptor tyrosine kinase of the Fak family. Predominantly expressed in the cells derived from hematopoietic lineages and in the central nervous system. Pyk2 is one of the signaling mediators for G-protein-coupled receptors. Involved in calcium induced regulation of ion channel and activation of the map kinase signaling pathway. Interacts with the SH2 domain of Grb2. May phosphorylate the voltage-gated potassium channel protein Kv1.2. Its activation is highly correlated with the stimulation of c-Jun N-terminal kinase activity. It plays an important role in cell motility such as spreading and migration. Two alternatively spliced isoforms have been described.

Protein type: EC 2.7.10.2; Kinase, protein; Nuclear receptor co-regulator; Protein kinase, tyrosine (non-receptor); Protein kinase, TK; TK group; Fak family

Chromosomal Location of Human Ortholog: 8p21.1

Cellular Component: focal adhesion; dendrite; postsynaptic density; cell cortex; cytosol; lipid raft; N-methyl-D-aspartate selective glutamate receptor complex; nucleoplasm; extrinsic to internal side of plasma membrane; growth cone; cytoskeleton; cell soma; lamellipodium; axon; perinuclear region of cytoplasm; cytoplasm; nucleus

Molecular Function: protein binding; signal transducer activity; calmodulin-dependent protein kinase activity; protein-tyrosine kinase activity; N-methyl-D-aspartate selective glutamate receptor activity; 3-phosphoinositide-dependent protein kinase binding; non-membrane spanning protein tyrosine kinase activity; protein complex binding; ATP binding; receptor binding

Biological Process: focal adhesion formation; positive regulation of JNK activity; regulation of nitric oxide biosynthetic process; regulation of cGMP biosynthetic process; protein amino acid phosphorylation; glial cell proliferation; regulation of cell shape; regulation of inositol trisphosphate biosynthetic process; negative regulation of bone mineralization; elevation of cytosolic calcium ion concentration; cell surface receptor linked signal transduction; tumor necrosis factor-mediated signaling pathway; response to glucose stimulus; protein complex assembly; negative regulation of neuron apoptosis; neurite development; bone resorption; response to drug; negative regulation of myeloid cell differentiation; positive regulation of nitric-oxide synthase activity; response to osmotic stress; positive regulation of cell growth; marginal zone B cell differentiation; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of angiogenesis; response to ethanol; ionotropic glutamate receptor signaling pathway; response to mechanical stimulus; response to calcium ion; negative regulation of apoptosis; activation of JAK protein; response to cAMP; peptidyl-tyrosine phosphorylation; blood vessel endothelial cell migration; positive regulation of translation; apoptosis; response to lithium ion; negative regulation of potassium ion transport; protein amino acid autophosphorylation; response to hormone stimulus; regulation of calcium-mediated signaling; positive regulation of JNK cascade; signal transduction; positive regulation of synaptic transmission, glutamatergic; negative regulation of cell proliferation; positive regulation of cell proliferation; response to stress; angiogenesis; positive regulation of cell-matrix adhesion; regulation of cell adhesion; integrin-mediated signaling pathway; epidermal growth factor receptor signaling pathway; MAPKKK cascade; positive regulation of phosphoinositide 3-kinase activity; signal complex assembly; response to cocaine; oocyte maturation; regulation of release of sequestered calcium ion into cytosol; response to hydrogen peroxide; positive regulation of actin filament polymerization; positive regulation of protein kinase activity; response to hypoxia; stress fiber formation; innate immune response; cellular defense response; sprouting angiogenesis; vascular endothelial growth factor receptor signaling pathway; positive regulation of cell migration

Research Articles on PTK2B

Similar Products

Product Notes

The PTK2B ptk2b (Catalog #AAA3201099) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PTK2B antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PTK2B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PTK2B ptk2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KSPLTPEKEV GYLEFTGPPQ KPPRLGAQSI QPTANLDRTD DLVYLNVMEL. It is sometimes possible for the material contained within the vial of "PTK2B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.