Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Leukotriene-B(4) omega-hydroxylase 2 (Cyp4f3) Recombinant Protein | Cyp4f3 recombinant protein

Recombinant Mouse Leukotriene-B (4) omega-hydroxylase 2 (Cyp4f3)

Gene Names
Cyp4f18; Cyp4f3; Cypf18; 1810054N16Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Leukotriene-B(4) omega-hydroxylase 2 (Cyp4f3); Recombinant Mouse Leukotriene-B (4) omega-hydroxylase 2 (Cyp4f3); Cyp4f3 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-524aa; full length protein
Sequence
MSQLSMSWMGLGHTAASPWLLLLLAGASCLLAYILTPIYGVFENSLRLRCFPQPPKRNWI LGHLGLIQSSEEGLLYIQSLVRTFRDACCWWVGPLHPVIRIFHPAFIKPVVLAPALVAPK DTVFYRFLKPWLGDGLLMSTGDKWSRHRRMLTPAFHFNILKPYVKVFNDSTNIMHAKWQR LASKGSAYLNMFEHISLMTLDSLQKCVFSFDSNCQEKPSEYITAILELSTLVARRHQRLL LHVDLFYYLTHDGMRFRKACRLVHDFTDAVIRERRRTLLDQGGVDVLKAKAKAKTLDFID VLLLSKDEHGKALSDEDIRAEADTFMFGGHDTTASGLSWILYNLARHPEYQERCRQEVRE LLRDREPEEIEWDDLAQLPFLTMCIKESLRLHPPVTAISRCCTQDIVLPDGRVIPKGVIS RISIFGTHHNPAVWPDPEVYDPFRFDADNVKGRSPLAFIPFSAGPRNCIGQTFAMSEMKV ALALTLLRFRVLPDDKEPRRKPELILRAEGGLWLKVEPLSAGAQ
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Cyp4f3 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59,843 Da
NCBI Official Full Name
leukotriene-B(4) omega-hydroxylase 2
NCBI Official Synonym Full Names
cytochrome P450, family 4, subfamily f, polypeptide 18
NCBI Official Symbol
Cyp4f18
NCBI Official Synonym Symbols
Cyp4f3; Cypf18; 1810054N16Rik
NCBI Protein Information
leukotriene-B(4) omega-hydroxylase 2
UniProt Protein Name
Leukotriene-B(4) omega-hydroxylase 2
UniProt Gene Name
Cyp4f3
UniProt Entry Name
CP4F3_MOUSE

Uniprot Description

CYP4F3: Cytochromes P450 are a group of heme-thiolate monooxygenases. This enzyme requires molecular oxygen and NADPH for the omega-hydroxylation of LTB4, a potent chemoattractant for polymorphonuclear leukocytes. Belongs to the cytochrome P450 family.

Protein type: Oxidoreductase; EC 1.14.13.30; Membrane protein, integral; Lipid Metabolism - arachidonic acid

Cellular Component: apical plasma membrane; cytoplasm; endoplasmic reticulum; integral to membrane; intracellular membrane-bound organelle; membrane

Molecular Function: alkane 1-monooxygenase activity; arachidonic acid epoxygenase activity; heme binding; iron ion binding; leukotriene-B4 20-monooxygenase activity; metal ion binding; monooxygenase activity; oxidoreductase activity; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NADH or NADPH as one donor, and incorporation of one atom of oxygen

Biological Process: arachidonic acid metabolic process; drug metabolic process; epoxygenase P450 pathway; long-chain fatty acid metabolic process; menaquinone catabolic process; negative regulation of icosanoid secretion; phylloquinone catabolic process; positive regulation of icosanoid secretion; regulation of blood pressure; very-long-chain fatty acid metabolic process; vitamin E metabolic process; vitamin K catabolic process

Research Articles on Cyp4f3

Similar Products

Product Notes

The Cyp4f3 cyp4f3 (Catalog #AAA7013460) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-524aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Cyp4f3 cyp4f3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSQLSMSWMG LGHTAASPWL LLLLAGASCL LAYILTPIYG VFENSLRLRC FPQPPKRNWI LGHLGLIQSS EEGLLYIQSL VRTFRDACCW WVGPLHPVIR IFHPAFIKPV VLAPALVAPK DTVFYRFLKP WLGDGLLMST GDKWSRHRRM LTPAFHFNIL KPYVKVFNDS TNIMHAKWQR LASKGSAYLN MFEHISLMTL DSLQKCVFSF DSNCQEKPSE YITAILELST LVARRHQRLL LHVDLFYYLT HDGMRFRKAC RLVHDFTDAV IRERRRTLLD QGGVDVLKAK AKAKTLDFID VLLLSKDEHG KALSDEDIRA EADTFMFGGH DTTASGLSWI LYNLARHPEY QERCRQEVRE LLRDREPEEI EWDDLAQLPF LTMCIKESLR LHPPVTAISR CCTQDIVLPD GRVIPKGVIS RISIFGTHHN PAVWPDPEVY DPFRFDADNV KGRSPLAFIP FSAGPRNCIG QTFAMSEMKV ALALTLLRFR VLPDDKEPRR KPELILRAEG GLWLKVEPLS AGAQ. It is sometimes possible for the material contained within the vial of "Leukotriene-B(4) omega-hydroxylase 2 (Cyp4f3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.