Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse anti-Human CYP4F3 Monoclonal Antibody | anti-CYP4F3 antibody

CYP4F3 (Cytochrome P450 4F3, CYPIVF3, Leukotriene-B(4) omega-hydroxylase 2, Leukotriene-B(4) 20-monooxygenase 2, Cytochrome P450-LTB-omega, LTB4H) APC

Gene Names
CYP4F3; CPF3; CYP4F; LTB4H
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CYP4F3; Monoclonal Antibody; CYP4F3 (Cytochrome P450 4F3; CYPIVF3; Leukotriene-B(4) omega-hydroxylase 2; Leukotriene-B(4) 20-monooxygenase 2; Cytochrome P450-LTB-omega; LTB4H) APC; anti-CYP4F3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4E11
Specificity
Recognizes human CYP4F3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-CYP4F3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa100-198 from human CYP4F3 (NP_000887) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RIFHPTYIKPVLFAPAAIVPKDKVFYSFLKPWLGDGLLLSAGEKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQLLASEGSARLDMFEHISLM
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Testing Data

(Detection limit for recombinant GST tagged CYP4F3 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CYP4F3 is 1ng/ml as a capture antibody.)
Related Product Information for anti-CYP4F3 antibody
CYP4F3 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. The enzyme starts the process of inactivating and degrading leukotriene B4, a potent mediator of inflammation.
Product Categories/Family for anti-CYP4F3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
docosahexaenoic acid omega-hydroxylase CYP4F3 isoform a
NCBI Official Synonym Full Names
cytochrome P450 family 4 subfamily F member 3
NCBI Official Symbol
CYP4F3
NCBI Official Synonym Symbols
CPF3; CYP4F; LTB4H
NCBI Protein Information
docosahexaenoic acid omega-hydroxylase CYP4F3
UniProt Protein Name
Leukotriene-B(4) omega-hydroxylase 2
UniProt Gene Name
CYP4F3
UniProt Synonym Gene Names
LTB4H
UniProt Entry Name
CP4F3_HUMAN

NCBI Description

This gene, CYP4F3, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. The enzyme starts the process of inactivating and degrading leukotriene B4, a potent mediator of inflammation. This gene is part of a cluster of cytochrome P450 genes on chromosome 19. Another member of this family, CYP4F8, is approximately 18 kb away. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Nov 2010]

Uniprot Description

CYP4F3: Cytochromes P450 are a group of heme-thiolate monooxygenases. This enzyme requires molecular oxygen and NADPH for the omega-hydroxylation of LTB4, a potent chemoattractant for polymorphonuclear leukocytes. Belongs to the cytochrome P450 family.

Protein type: EC 1.14.13.30; Oxidoreductase; Membrane protein, integral; Lipid Metabolism - arachidonic acid

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: endoplasmic reticulum membrane; integral to membrane

Molecular Function: leukotriene-B4 20-monooxygenase activity; iron ion binding; heme binding; monooxygenase activity

Biological Process: xenobiotic metabolic process; icosanoid metabolic process; arachidonic acid metabolic process; leukotriene metabolic process

Research Articles on CYP4F3

Similar Products

Product Notes

The CYP4F3 cyp4f3 (Catalog #AAA6136146) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CYP4F3 (Cytochrome P450 4F3, CYPIVF3, Leukotriene-B(4) omega-hydroxylase 2, Leukotriene-B(4) 20-monooxygenase 2, Cytochrome P450-LTB-omega, LTB4H) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CYP4F3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CYP4F3 cyp4f3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CYP4F3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.