Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Cytochrome P450 27C1 (CYP27C1) Recombinant Protein | CYP27C1 recombinant protein

Recombinant Human Cytochrome P450 27C1 (CYP27C1)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cytochrome P450 27C1 (CYP27C1); Recombinant Human Cytochrome P450 27C1 (CYP27C1); CYP27C1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-372, Full length protein
Sequence
MRSVLRQRILKPKDVAIYSGEVNQVIADLIKRIYLLRSQAEDGETVTNVNDLFFKYSMEGVATILYESRLGCLENSIPQLTVEYIEALELMFSMFKTSMYAGAIPRWLRPFIPKPWREFCRSWDGLFKFSQIHVDNKLRDIQYQMDRGRRVSGGLLTYLFLSQALTLQEIYANVTEMLLAGVDTTSFTLSWTVYLLARHPEVQQTVYREIVKNLGERHVPTAADVPKVPLVRALLKETLRLFPVLPGNGRVTQEDLVIGGYLIPKGTQLALCHYATSYQDENFPRAKEFRPERWLRKGDLDRVDNFGSIPFGHGVRSCIGRRIAELEIHLVVIQLLQHFEIKTSSQTNAVHAKTHGLLTPGGPIHVRFVNRK
Sequence Length
372
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for CYP27C1 recombinant protein
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,632 Da
NCBI Official Full Name
cytochrome P450 27C1
NCBI Official Synonym Full Names
cytochrome P450 family 27 subfamily C member 1
NCBI Official Symbol
CYP27C1
NCBI Protein Information
cytochrome P450 27C1
UniProt Protein Name
Cytochrome P450 27C1
Protein Family
UniProt Gene Name
CYP27C1

NCBI Description

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. [provided by RefSeq, Jul 2008]

Uniprot Description

Catalyzes the conversion of all-trans retinol (also called vitamin A1, the precursor of 11-cis retinal) to 3,4-didehydroretinol (also called vitamin A2, the precursor of 11-cis 3,4-didehydroretinal). Also acts on all-trans retinal and all-trans retinoic acid.

Research Articles on CYP27C1

Similar Products

Product Notes

The CYP27C1 cyp27c1 (Catalog #AAA1401467) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-372, Full length protein. The amino acid sequence is listed below: MRSVLRQRIL KPKDVAIYSG EVNQVIADLI KRIYLLRSQA EDGETVTNVN DLFFKYSMEG VATILYESRL GCLENSIPQL TVEYIEALEL MFSMFKTSMY AGAIPRWLRP FIPKPWREFC RSWDGLFKFS QIHVDNKLRD IQYQMDRGRR VSGGLLTYLF LSQALTLQEI YANVTEMLLA GVDTTSFTLS WTVYLLARHP EVQQTVYREI VKNLGERHVP TAADVPKVPL VRALLKETLR LFPVLPGNGR VTQEDLVIGG YLIPKGTQLA LCHYATSYQD ENFPRAKEFR PERWLRKGDL DRVDNFGSIP FGHGVRSCIG RRIAELEIHL VVIQLLQHFE IKTSSQTNAV HAKTHGLLTP GGPIHVRFVN RK. It is sometimes possible for the material contained within the vial of "Cytochrome P450 27C1 (CYP27C1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.