Steroid 21-hydroxylase (CYP21) Recombinant Protein | CYP21 recombinant protein
Recombinant Dog Steroid 21-hydroxylase (CYP21)
Gene Names
CYP21A2; CYP21; CYP21A
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Steroid 21-hydroxylase (CYP21); Recombinant Dog Steroid 21-hydroxylase (CYP21); CYP21 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-492, Full length protein
Sequence
MLLLGVLLLTVLAGARLLWGKWKLRGLHLPPLVPGCLHLLQPDLPLHLLGLTQKLGPIYRLRLGLQDVVVLNSKRTIEEAMVRKWVDFAGRPQTPSYKLVSLHHQDLSLGDYSLLWKAHKKLTRSALLLGIRSSMEPLVEQLTQEFCERMRAQAGTPVAIQKEFSLLTCAIICHLTFGDKEDTLVHTFHDCVQDLMRTWEHWSIQMLDIIPFLRFFPNPGLWRLKRALENRDHIVEKQLRQHKESMVAGQWRDMTDYMLQRVGRLRAEEGCGQLLEGHVHMSVVDLFIGGTETTATTLSWAVAFLLHHPEIQQRLQEELDRELGPGASGSRIPYRDPTRLPLLSATVAEVLRLRPVVPLALPHCTTRPSSISGYDIPEGMVVIPNLQGAHLDETVWERPQEFRPDRFLVPGASPRVLAFGCGARVCLGEPLARLELLVVLAQLLRAFTLMPAAGTLPSLRPRARCGVNLSMQPFQVQLQPRGAGVLGRGQHP
Sequence Length
492
Species
Canis familiaris (Dog) (Canis lupus familiaris)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
55,366 Da
NCBI Official Full Name
Steroid 21-hydroxylase
NCBI Official Symbol
CYP21A2
NCBI Official Synonym Symbols
CYP21; CYP21A
NCBI Protein Information
steroid 21-hydroxylase
UniProt Protein Name
Steroid 21-hydroxylase
Protein Family
UniProt Gene Name
CYP21
Uniprot Description
Specifically catalyzes the 21-hydroxylation of steroids. Required for the adrenal synthesis of mineralocorticoids and glucocorticoids.
Similar Products
Product Notes
The CYP21 cyp21 (Catalog #AAA1332655) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-492, Full length protein. The amino acid sequence is listed below: MLLLGVLLLT VLAGARLLWG KWKLRGLHLP PLVPGCLHLL QPDLPLHLLG LTQKLGPIYR LRLGLQDVVV LNSKRTIEEA MVRKWVDFAG RPQTPSYKLV SLHHQDLSLG DYSLLWKAHK KLTRSALLLG IRSSMEPLVE QLTQEFCERM RAQAGTPVAI QKEFSLLTCA IICHLTFGDK EDTLVHTFHD CVQDLMRTWE HWSIQMLDII PFLRFFPNPG LWRLKRALEN RDHIVEKQLR QHKESMVAGQ WRDMTDYMLQ RVGRLRAEEG CGQLLEGHVH MSVVDLFIGG TETTATTLSW AVAFLLHHPE IQQRLQEELD RELGPGASGS RIPYRDPTRL PLLSATVAEV LRLRPVVPLA LPHCTTRPSS ISGYDIPEGM VVIPNLQGAH LDETVWERPQ EFRPDRFLVP GASPRVLAFG CGARVCLGEP LARLELLVVL AQLLRAFTLM PAAGTLPSLR PRARCGVNLS MQPFQVQLQP RGAGVLGRGQ HP. It is sometimes possible for the material contained within the vial of "Steroid 21-hydroxylase (CYP21), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
