Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

C-X-C motif chemokine 2 Recombinant Protein | CXCL2 recombinant protein

Recombinant Mouse C-X-C motif chemokine 2 protein

Gene Names
Cxcl2; GROb; Gro2; Mip2; Scyb; MIP-2; Scyb2; MIP-2a; Mgsa-b; CINC-2a
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
C-X-C motif chemokine 2; Recombinant Mouse C-X-C motif chemokine 2 protein; Macrophage inflammatory protein 2; MIP2; CXCL2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
28-100aa; Full Length
Sequence
AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN
Sequence Length
100
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for CXCL2 recombinant protein
Chotactic for human polymorphonuclear leukocytes but does not induce chokinesis or an oxidative burst.
References
Cloning and characterization of cDNAs for murine macrophage inflammatory protein 2 and its human homologues.Tekamp-Olson P., Gallegos C., Bauer D., McClain J., Sherry B., Fabre M., van Deventer S., Cerami A.J. Exp. Med. 172:911-919(1990) Identification and characterization of macrophage inflammatory protein 2.Wolpe S.D., Sherry B., Juers D., Davatelis G., Yurt R.W., Cerami A.Proc. Natl. Acad. Sci. U.S.A. 86:612-616(1989) Solution structure of murine macrophage inflammatory protein-2.Shao W., Jerva L.F., West J., Lolis E., Schweitzer B.I.Biochemistry 37:8303-8313(1998)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11.8 kDa
NCBI Official Full Name
C-X-C motif chemokine 2
NCBI Official Synonym Full Names
chemokine (C-X-C motif) ligand 2
NCBI Official Symbol
Cxcl2
NCBI Official Synonym Symbols
GROb; Gro2; Mip2; Scyb; MIP-2; Scyb2; MIP-2a; Mgsa-b; CINC-2a
NCBI Protein Information
C-X-C motif chemokine 2
UniProt Protein Name
C-X-C motif chemokine 2
Protein Family
UniProt Gene Name
Cxcl2
UniProt Synonym Gene Names
Mip-2; Mip2; Scyb2; MIP2
UniProt Entry Name
CXCL2_MOUSE

Uniprot Description

Chemotactic for human polymorphonuclear leukocytes but does not induce chemokinesis or an oxidative burst.

Research Articles on CXCL2

Similar Products

Product Notes

The CXCL2 cxcl2 (Catalog #AAA717328) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 28-100aa; Full Length. The amino acid sequence is listed below: AVVASELRCQ CLKTLPRVDF KNIQSLSVTP PGPHCAQTEV IATLKGGQKV CLDPEAPLVQ KIIQKILNKG KAN. It is sometimes possible for the material contained within the vial of "C-X-C motif chemokine 2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.