C-X-C motif chemokine 11 (Cxcl11) Recombinant Protein | Cxcl11 recombinant protein
Recombinant Mouse C-X-C motif chemokine 11 (Cxcl11)
Gene Names
Cxcl11; Ip9; H174; Itac; b-R1; Cxc11; I-tac; Scyb11; Scyb9b; betaR1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
C-X-C motif chemokine 11 (Cxcl11); Recombinant Mouse C-X-C motif chemokine 11 (Cxcl11); Cxcl11 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-100, full length protein
Sequence
FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQNM
Sequence Length
79
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Cxcl11 recombinant protein
Chemokines are a group of small (approximately 8 to 14 kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Chemokines are divided into 2 major subfamilies, CXC and CC. This gene is a CXC member of the chemokine superfamily. Its encoded protein induces a chemotactic response in activated T-cells and is the dominant ligand for CXC receptor-3. The gene encoding this protein contains 4 exons and at least three polyadenylation signals which might reflect cell-specific regulation of expression. IFN-gamma is a potent inducer of transcription of this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11,266 Da
NCBI Official Full Name
C-X-C motif chemokine 11
NCBI Official Synonym Full Names
chemokine (C-X-C motif) ligand 11
NCBI Official Symbol
Cxcl11
NCBI Official Synonym Symbols
Ip9; H174; Itac; b-R1; Cxc11; I-tac; Scyb11; Scyb9b; betaR1
NCBI Protein Information
C-X-C motif chemokine 11
UniProt Protein Name
C-X-C motif chemokine 11
Protein Family
UniProt Gene Name
Cxcl11
UniProt Synonym Gene Names
Scyb11; I-TAC
Uniprot Description
Chemotactic for interleukin-activated T-cells but not unstimulated T-cells, neutrophils or monocytes. Induces calcium release in activated T-cells. Binds to CXCR3. May play an important role in CNS diseases which involve T-cell recruitment. May play a role in skin immune responses ().
Research Articles on Cxcl11
Similar Products
Product Notes
The Cxcl11 cxcl11 (Catalog #AAA1290064) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-100, full length protein. The amino acid sequence is listed below: FLMFKQGRCL CIGPGMKAVK MAEIEKASVI YPSNGCDKVE VIVTMKAHKR QRCLDPRSKQ ARLIMQAIEK KNFLRRQNM. It is sometimes possible for the material contained within the vial of "C-X-C motif chemokine 11 (Cxcl11), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
