Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CX3C chemokine receptor 1 (Cx3cr1) Recombinant Protein | Cx3cr1 recombinant protein

Recombinant Rat CX3C chemokine receptor 1 (Cx3cr1)

Gene Names
Cx3cr1; Rbs11
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
CX3C chemokine receptor 1 (Cx3cr1); Recombinant Rat CX3C chemokine receptor 1 (Cx3cr1); Recombinant CX3C chemokine receptor 1 (Cx3cr1); CX3C chemokine receptor 1; C-X3-C CKR-1; CX3CR1; Fractalkine receptor RBS11; Cx3cr1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-354
Sequence
MPTSFPELDLENFEYDDSAEACYLGDIVAFGTIFLSIFYSLVFTFGLVGNLLVVLALTNSRKSKSITDIYLLNLALSDLLFVATLPFWTHYLISHEGLHNAMCKLTTAFFFIGFFGGIFFITVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVASPQFMFTKRKDNECLGDYPEVLQEIWPVLRNSEVNILGFVLPLLIMSFCYFRIVRTLFSCKNRKKARAIRLILLVVVVFFLFWTPYNIVIFLETLKFYNFFPSCGMKRDLRWALSVTETVAFSHCCLNPFIYAFAGEKFRRYLRHLYNKCLAVLCGRPVHAGFSTESQRSRQDSILSSLTHYTSEGEGSLLL
Sequence Length
354
Species
Rattus norvegicus (Rat)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,327 Da
NCBI Official Full Name
CX3C chemokine receptor 1
NCBI Official Synonym Full Names
chemokine (C-X3-C motif) receptor 1
NCBI Official Symbol
Cx3cr1
NCBI Official Synonym Symbols
Rbs11
NCBI Protein Information
CX3C chemokine receptor 1; C-X3-C CKR-1; fractalkine receptor; chemokine (C-X3-C) receptor 1
UniProt Protein Name
CX3C chemokine receptor 1
Protein Family
UniProt Gene Name
Cx3cr1
UniProt Synonym Gene Names
Rbs11; C-X3-C CKR-1; CX3CR1
UniProt Entry Name
CX3C1_RAT

NCBI Description

member of the rhodopsin family of G-protein coupled receptors; may act as a receptor for a chemokine peptide ligand [RGD, Feb 2006]

Uniprot Description

CX3CR1: Receptor for the CX3C chemokine fractalkine and mediates both its adhesive and migratory functions. Acts as coreceptor with CD4 for HIV-1 virus envelope protein (in vitro). Isoform 2 and isoform 3 seem to be more potent HIV-1 coreceptors than isoform 1. Defects in CX3CR1 are a cause of susceptibility to age- related macular degeneration type 12 (ARMD12). ARMD12 is a form of age-related macular degeneration, a multifactorial eye disease and the most common cause of irreversible vision loss in the developed world. In most patients, the disease is manifest as ophthalmoscopically visible yellowish accumulations of protein and lipid that lie beneath the retinal pigment epithelium and within an elastin-containing structure known as Bruch membrane. Belongs to the G-protein coupled receptor 1 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Cell adhesion; GPCR, family 1; Membrane protein, integral; Motility/polarity/chemotaxis; Receptor, cytokine; Receptor, GPCR

Cellular Component: neuron projection; perinuclear region of cytoplasm; integral to membrane

Molecular Function: hematopoietin/interferon-class (D200-domain) cytokine receptor activity; C-X3-C chemokine receptor activity

Biological Process: positive regulation of neuroblast proliferation; cytokine and chemokine mediated signaling pathway; microglial cell activation; macrophage chemotaxis; memory; G-protein coupled receptor protein signaling pathway; negative regulation of angiogenesis; positive regulation of angiogenesis; negative regulation of chronic inflammatory response to non-antigenic stimulus; cerebral cortex cell migration; cell adhesion; negative regulation of cell migration; microglial cell activation during immune response

Research Articles on Cx3cr1

Similar Products

Product Notes

The Cx3cr1 cx3cr1 (Catalog #AAA1263997) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-354. The amino acid sequence is listed below: MPTSFPELDL ENFEYDDSAE ACYLGDIVAF GTIFLSIFYS LVFTFGLVGN LLVVLALTNS RKSKSITDIY LLNLALSDLL FVATLPFWTH YLISHEGLHN AMCKLTTAFF FIGFFGGIFF ITVISIDRYL AIVLAANSMN NRTVQHGVTI SLGVWAAAIL VASPQFMFTK RKDNECLGDY PEVLQEIWPV LRNSEVNILG FVLPLLIMSF CYFRIVRTLF SCKNRKKARA IRLILLVVVV FFLFWTPYNI VIFLETLKFY NFFPSCGMKR DLRWALSVTE TVAFSHCCLN PFIYAFAGEK FRRYLRHLYN KCLAVLCGRP VHAGFSTESQ RSRQDSILSS LTHYTSEGEG SLLL. It is sometimes possible for the material contained within the vial of "CX3C chemokine receptor 1 (Cx3cr1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.