Cystatin D Recombinant Protein | CST5 recombinant protein

Recombinant Human Cystatin D Protein

Cat. Num. AAA9141870

• Purity: >90% by SDS-PAGE.
• Synonyms: Cystatin D; Recombinant Human Cystatin D Protein; CST5; MGC71922; CST5 recombinant protein

• Host: HEK293 Cells
• Purity/Purification: >90% by SDS-PAGE.
• Form/Format: Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
• Sequence: GSASAQSRTLAGGIHATDLNDKSVQCALDFAISEYNKVINKDEYYSRPLQVMAAYQQIVGGVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCSFQINEVPWEDKISILNYKCRKV
• Sequence Length: 142

• Species: Human
• Endotoxin: < 0.1 EU/ug of the protein by LAL method.
• Reconstitution: Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
• Tag: 6xHis tag at the C-terminus
• Preparation and Storage: Store the lyophilized protein at -20 degree C to -80 degree C for long term.; After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human Cystatin D Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 15 kDa.)

Related Product Information for CST5 recombinant protein

Description: Recombinant Human Cystatin D Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly21-Val142) of human Cystatin D (Accession #NP_001891.2) fused with a 6xHis tag at the C-terminus.

Background: The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Cystatins are natural inhibitors of papain-like (family C1) and legumain-related (family C13) cysteine peptidases. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. As a member of type 2 cystatin, cystatin D is a single-domain protein and also has cysteine residues that form disulfide bridges. The functions of Cystatin D are largely unknown. However, Cystatin D has been shown to inhibit coronavirus replication at its physiological concentration (0.12_x005f

Product Categories/Family for CST5 recombinant protein

Other Recombinant Protein

NCBI and Uniprot Product Information

• NCBI GI #: 19882256
• NCBI GeneID: 1473
• NCBI Accession #: NP_001891.2
• NCBI GenBank Nucleotide #: NP_001891.2
• UniProt Accession #: P28325
• NCBI Official Full Name: cystatin-D
• NCBI Official Synonym Full Names: cystatin D
• NCBI Official Symbol: CST5
• NCBI Protein Information: cystatin-D
• UniProt Protein Name: Cystatin-D
• Protein Family: Cystatin
• UniProt Gene Name: CST5
• UniProt Entry Name: CYTD_HUMAN

NCBI Description

The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a protein found in saliva and tears. The encoded protein may play a protective role against proteinases present in the oral cavity. [provided by RefSeq, Jul 2008]

Uniprot Description

CST5: Cysteine proteinase inhibitor that possibly plays a protective role against proteinases present in the oral cavity. The order of preference for inhibition is cathepsin S > cathepsin H > cathepsin L > cathepsin B. Belongs to the cystatin family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 20p11.21

Cellular Component: extracellular region; extracellular space

Molecular Function: cysteine protease inhibitor activity; protease binding; protein binding