Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Cysteine and glycine-rich protein 2 Recombinant Protein | CSRP2 recombinant protein

Recombinant Human Cysteine and glycine-rich protein 2

Gene Names
CSRP2; CRP2; LMO5; SmLIM
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cysteine and glycine-rich protein 2; Recombinant Human Cysteine and glycine-rich protein 2; Cysteine-rich protein 2; CRP2LIM domain only protein 5; LMO-5; Smooth muscle cell LIM protein; SmLIM; CSRP2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
2-193aa; Full Length
Sequence
PVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKSCYGKKYGPKGYGYGQGAGTLNMDRGERLGIKPESVQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ
Sequence Length
193
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for CSRP2 recombinant protein
Drastically down-regulated in response to PDGF-BB or cell injury, that promote smooth muscle cell proliferation and dedifferentiation. Ses to play a role in the development of the embryonic vascular system.
Product Categories/Family for CSRP2 recombinant protein
References
Molecular cloning and characterization of SmLIM, a developmentally regulated LIM protein preferentially expressed in aortic smooth muscle cells.Jain M., Fujita K.P., Hsieh C.-M., Endege W.O., Sibinga N.E.S., Yet S.-F., Kashiki S., Lee W.-S., Perrella M.A., Haber E., Lee M.-E.J. Biol. Chem. 271:10194-10199(1996)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24.8 kDa
NCBI Official Full Name
cysteine and glycine-rich protein 2
NCBI Official Synonym Full Names
cysteine and glycine rich protein 2
NCBI Official Symbol
CSRP2
NCBI Official Synonym Symbols
CRP2; LMO5; SmLIM
NCBI Protein Information
cysteine and glycine-rich protein 2
UniProt Protein Name
Cysteine and glycine-rich protein 2
UniProt Gene Name
CSRP2
UniProt Synonym Gene Names
LMO5; SMLIM; CRP2; LMO-5; SmLIM
UniProt Entry Name
CSRP2_HUMAN

NCBI Description

CSRP2 is a member of the CSRP family of genes, encoding a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. CRP2 contains two copies of the cysteine-rich amino acid sequence motif (LIM) with putative zinc-binding activity, and may be involved in regulating ordered cell growth. Other genes in the family include CSRP1 and CSRP3. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]

Uniprot Description

CSRP2: a LIM protein that is differentially regulated and preferentially expressed in aortic smooth muscle cells. Drastically down-regulated in response to PDGF-BB or cell injury, that promote smooth muscle cell proliferation and dedifferentiation. Seems to play a role in the development of the embryonic vascular system.

Protein type: Cell development/differentiation

Chromosomal Location of Human Ortholog: 12q21.1

Cellular Component: focal adhesion; nucleus

Molecular Function: protein binding; zinc ion binding

Biological Process: cell differentiation; multicellular organismal development; myoblast differentiation

Research Articles on CSRP2

Similar Products

Product Notes

The CSRP2 csrp2 (Catalog #AAA952271) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-193aa; Full Length. The amino acid sequence is listed below: PVWGGGNKCG ACGRTVYHAE EVQCDGRSFH RCCFLCMVCR KNLDSTTVAI HDEEIYCKSC YGKKYGPKGY GYGQGAGTLN MDRGERLGIK PESVQPHRPT TNPNTSKFAQ KYGGAEKCSR CGDSVYAAEK IIGAGKPWHK NCFRCAKCGK SLESTTLTEK EGEIYCKGCY AKNFGPKGFG YGQGAGALVH AQ. It is sometimes possible for the material contained within the vial of "Cysteine and glycine-rich protein 2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.