Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Beta-crystallin B3 (Crybb3) Recombinant Protein | Crybb3 recombinant protein

Recombinant Rat Beta-crystallin B3 (Crybb3)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Beta-crystallin B3 (Crybb3); Recombinant Rat Beta-crystallin B3 (Crybb3); Crybb3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-211, Full length protein
Sequence
MAEQHGAPEQAAASKSHGGLGGSYKVTVYELENFQGKRCELSAECPNLTESLLQKVGSIQVESGPWLAFERRAFRGEQFVLEKGDYPRWDAWSSSRRSDILLSLRPLHIDGPDHKLHLFENPAFSGRKMEIVDDDVPSLWAHGFQDRVASIRVINGTWVGYEFPGYRGRQYVFERGEFRHWNEWDANQPQLQSVRRIRDQKWHKRGCFLSS
Sequence Length
211
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Crybb3 recombinant protein
Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and gamma crystallins are also considered as a superfamily. Alpha and beta families are further divided into acidic and basic groups. Seven protein regions exist in crystallins: four homologous motifs, a connecting peptide, and N- and C-terminal extensions. Beta-crystallins, the most heterogeneous, differ by the presence of the C-terminal extension (present in the basic group, none in the acidic group). Beta-crystallins form aggregates of different sizes and are able to self-associate to form dimers or to form heterodimers with other beta-crystallins. This gene, a beta basic group member, is part of a gene cluster with beta-A4, beta-B1, and beta-B2.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,334 Da
NCBI Official Full Name
beta-crystallin B3
NCBI Official Synonym Full Names
crystallin, beta B3
NCBI Official Symbol
Crybb3
NCBI Protein Information
beta-crystallin B3
UniProt Protein Name
Beta-crystallin B3
Protein Family
UniProt Gene Name
Crybb3

NCBI Description

one of several lens beta crystallins [RGD, Feb 2006]

Uniprot Description

Crystallins are the dominant structural components of the vertebrate eye lens.

Similar Products

Product Notes

The Crybb3 crybb3 (Catalog #AAA953665) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-211, Full length protein. The amino acid sequence is listed below: MAEQHGAPEQ AAASKSHGGL GGSYKVTVYE LENFQGKRCE LSAECPNLTE SLLQKVGSIQ VESGPWLAFE RRAFRGEQFV LEKGDYPRWD AWSSSRRSDI LLSLRPLHID GPDHKLHLFE NPAFSGRKME IVDDDVPSLW AHGFQDRVAS IRVINGTWVG YEFPGYRGRQ YVFERGEFRH WNEWDANQPQ LQSVRRIRDQ KWHKRGCFLS S. It is sometimes possible for the material contained within the vial of "Beta-crystallin B3 (Crybb3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.