Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

CREB-regulated transcription coactivator 3 (CRTC3) Recombinant Protein | CRTC3 recombinant protein

Recombinant Human CREB-regulated transcription coactivator 3 (CRTC3)

Gene Names
CRTC3; TORC3; TORC-3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
CREB-regulated transcription coactivator 3 (CRTC3); Recombinant Human CREB-regulated transcription coactivator 3 (CRTC3); CRTC3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-619, Full length protein
Sequence
MAASPGSGSANPRKFSEKIALHTQRQAEETRAFEQLMTDLTLSRVQFQKLQQLRLTQYHGGSLPNVSQLRSSASEFQPSFHQADNVRGTRHHGLVERPSRNRFHPLHRRSGDKPGRQFDGSAFGANYSSQPLDESWPRQQPPWKDEKHPGFRLTSALNRTNSDSALHTSALSTKPQDPYGGGGQSAWPAPYMGFCDGENNGHGEVASFPGPLKEENLLNVPKPLPKQLWETKEIQSLSGRPRSCDVGGGNAFPHNGQNLGLSPFLGTLNTGGSLPDLTNLHYSTPLPASLDTTDHHFGSMSVGNSVNNIPAAMTHLGIRSSSGLQSSRSNPSIQATLNKTVLSSSLNNHPQTSVPNASALHPSLRLFSLSNPSLSTTNLSGPSRRRQPPVSPLTLSPGPEAHQGFSRQLSSTSPLAPYPTSQMVSSDRSQLSFLPTEAQAQVSPPPPYPAPQELTQPLLQQPRAPEAPAQQPQAASSLPQSDFQLLPAQGSSLTNFFPDVGFDQQSMRPGPAFPQQVPLVQQGSRELQDSFHLRPSPYSNCGSLPNTILPEDSSTSLFKDLNSALAGLPEVSLNVDTPFPLEEELQIEPLSLDGLNMLSDSSMGLLDPSVEETFRADRL
Sequence Length
619
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66,830 Da
NCBI Official Full Name
CREB-regulated transcription coactivator 3 isoform b
NCBI Official Synonym Full Names
CREB regulated transcription coactivator 3
NCBI Official Symbol
CRTC3
NCBI Official Synonym Symbols
TORC3; TORC-3
NCBI Protein Information
CREB-regulated transcription coactivator 3
UniProt Protein Name
CREB-regulated transcription coactivator 3
UniProt Gene Name
CRTC3
UniProt Synonym Gene Names
TORC3; TORC-3; Transducer of CREB protein 3

NCBI Description

This gene is a member of the CREB regulated transcription coactivator gene family. This family regulates CREB-dependent gene transcription in a phosphorylation-independent manner and may be selective for cAMP-responsive genes. The protein encoded by this gene may induce mitochondrial biogenesis and attenuate catecholamine signaling in adipose tissue. A translocation event between this gene and Notch coactivator mastermind-like gene 2, which results in a fusion protein, has been reported in mucoepidermoid carcinomas. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Jul 2012]

Uniprot Description

Transcriptional coactivator for CREB1 which activates transcription through both consensus and variant cAMP response element (CRE) sites. Acts as a coactivator, in the SIK/TORC signaling pathway, being active when dephosphorylated and acts independently of CREB1 'Ser-133' phosphorylation. Enhances the interaction of CREB1 with TAF4. Regulates the expression of specific CREB-activated genes such as the steroidogenic gene, StAR. Potent coactivator of PPARGC1A and inducer of mitochondrial biogenesis in muscle cells. Also coactivator for TAX activation of the human T-cell leukemia virus type 1 (HTLV-1) long terminal repeats (LTR).

Research Articles on CRTC3

Similar Products

Product Notes

The CRTC3 crtc3 (Catalog #AAA1425776) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-619, Full length protein. The amino acid sequence is listed below: MAASPGSGSA NPRKFSEKIA LHTQRQAEET RAFEQLMTDL TLSRVQFQKL QQLRLTQYHG GSLPNVSQLR SSASEFQPSF HQADNVRGTR HHGLVERPSR NRFHPLHRRS GDKPGRQFDG SAFGANYSSQ PLDESWPRQQ PPWKDEKHPG FRLTSALNRT NSDSALHTSA LSTKPQDPYG GGGQSAWPAP YMGFCDGENN GHGEVASFPG PLKEENLLNV PKPLPKQLWE TKEIQSLSGR PRSCDVGGGN AFPHNGQNLG LSPFLGTLNT GGSLPDLTNL HYSTPLPASL DTTDHHFGSM SVGNSVNNIP AAMTHLGIRS SSGLQSSRSN PSIQATLNKT VLSSSLNNHP QTSVPNASAL HPSLRLFSLS NPSLSTTNLS GPSRRRQPPV SPLTLSPGPE AHQGFSRQLS STSPLAPYPT SQMVSSDRSQ LSFLPTEAQA QVSPPPPYPA PQELTQPLLQ QPRAPEAPAQ QPQAASSLPQ SDFQLLPAQG SSLTNFFPDV GFDQQSMRPG PAFPQQVPLV QQGSRELQDS FHLRPSPYSN CGSLPNTILP EDSSTSLFKD LNSALAGLPE VSLNVDTPFP LEEELQIEPL SLDGLNMLSD SSMGLLDPSV EETFRADRL. It is sometimes possible for the material contained within the vial of "CREB-regulated transcription coactivator 3 (CRTC3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.