Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Cytokine receptor-like factor 1 (CRLF1) Recombinant Protein | CRLF1 recombinant protein

Recombinant Human Cytokine receptor-like factor 1 (CRLF1)

Gene Names
CRLF1; CLF; NR6; CISS; CISS1; CLF-1; zcytor5
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cytokine receptor-like factor 1 (CRLF1); Recombinant Human Cytokine receptor-like factor 1 (CRLF1); CRLF1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
38-422, Full length protein
Sequence
AHTAVISPQDPTLLIGSSLLATCSVHGDPPGATAEGLYWTLNGRRLPPELSRVLNASTLALALANLNGSRQRSGDNLVCHARDGSILAGSCLYVGLPPEKPVNISCWSKNMKDLTCRWTPGAHGETFLHTNYSLKYKLRWYGQDNTCEEYHTVGPHSCHIPKDLALFTPYEIWVEATNRLGSARSDVLTLDILDVVTTDPPPDVHVSRVGGLEDQLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAGLKPGTVYFVQVRCNPFGIYGSKKAGIWSEWSHPTAASTPRSERPGPGGGACEPRGGEPSSGPVRRELKQFLGWLKKHAYCSNLSFRLYDQWRAWMQKSHKTRNQDEGILPSGRRGTARGPAR
Sequence Length
385
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for CRLF1 recombinant protein
This gene encodes a member of the cytokine type I receptor family. The protein forms a secreted complex with cardiotrophin-like cytokine factor 1 and acts on cells expressing ciliary neurotrophic factor receptors. The complex can promote survival of neuronal cells. Mutations in this gene result in Crisponi syndrome and cold-induced sweating syndrome.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46,302 Da
NCBI Official Full Name
cytokine receptor-like factor 1
NCBI Official Synonym Full Names
cytokine receptor like factor 1
NCBI Official Symbol
CRLF1
NCBI Official Synonym Symbols
CLF; NR6; CISS; CISS1; CLF-1; zcytor5
NCBI Protein Information
cytokine receptor-like factor 1
UniProt Protein Name
Cytokine receptor-like factor 1
UniProt Gene Name
CRLF1
UniProt Synonym Gene Names
CLF-1

NCBI Description

This gene encodes a member of the cytokine type I receptor family. The protein forms a secreted complex with cardiotrophin-like cytokine factor 1 and acts on cells expressing ciliary neurotrophic factor receptors. The complex can promote survival of neuronal cells. Mutations in this gene result in Crisponi syndrome and cold-induced sweating syndrome. [provided by RefSeq, Oct 2009]

Uniprot Description

Cytokine receptor subunit, possibly playing a regulatory role in the immune system and during fetal development. May be involved in nervous system development.

Research Articles on CRLF1

Similar Products

Product Notes

The CRLF1 crlf1 (Catalog #AAA1158820) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 38-422, Full length protein. The amino acid sequence is listed below: AHTAVISPQD PTLLIGSSLL ATCSVHGDPP GATAEGLYWT LNGRRLPPEL SRVLNASTLA LALANLNGSR QRSGDNLVCH ARDGSILAGS CLYVGLPPEK PVNISCWSKN MKDLTCRWTP GAHGETFLHT NYSLKYKLRW YGQDNTCEEY HTVGPHSCHI PKDLALFTPY EIWVEATNRL GSARSDVLTL DILDVVTTDP PPDVHVSRVG GLEDQLSVRW VSPPALKDFL FQAKYQIRYR VEDSVDWKVV DDVSNQTSCR LAGLKPGTVY FVQVRCNPFG IYGSKKAGIW SEWSHPTAAS TPRSERPGPG GGACEPRGGE PSSGPVRREL KQFLGWLKKH AYCSNLSFRL YDQWRAWMQK SHKTRNQDEG ILPSGRRGTA RGPAR. It is sometimes possible for the material contained within the vial of "Cytokine receptor-like factor 1 (CRLF1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.