SDS-PAGE
Cysteine-rich protein 2 Recombinant Protein | P52943 recombinant protein
Recombinant Human Cysteine-rich protein 2
Gene Names
CRIP2; CRIP; CRP2; ESP1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cysteine-rich protein 2; Recombinant Human Cysteine-rich protein 2; Protein ESP1; P52943 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-208aa; Full Length
Sequence
MASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCSKTLTPGGHAEHDGKPFCHKPCYATLFGPKGVNIGGAGSYIYEKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCPRCSKKVYFAEKVTSLGKDWHRPCLRCERCGKTLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDRDPEGKVQP
Sequence Length
208
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
References
Human ESP1/CRP2, a member of the LIM domain protein family
characterization of the cDNA and assignment of the gene locus to chromosome 14q32.3.Karim M.A., Ohta K., Egashira M., Jinno Y., Niikawa N., Matsuda I., Indo Y.Genomics 31:167-176(1996)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
38.5 kDa
NCBI Official Full Name
cysteine-rich protein 2 isoform 2
NCBI Official Synonym Full Names
cysteine rich protein 2
NCBI Official Symbol
CRIP2
NCBI Official Synonym Symbols
CRIP; CRP2; ESP1
NCBI Protein Information
cysteine-rich protein 2
UniProt Protein Name
Cysteine-rich protein 2
Protein Family
UniProt Gene Name
CRIP2
UniProt Synonym Gene Names
CRP2; CRP-2
UniProt Entry Name
CRIP2_HUMAN
NCBI Description
This gene encodes a putative transcription factor with two LIM zinc-binding domains. The encoded protein may participate in the differentiation of smooth muscle tissue. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]
Uniprot Description
CRIP2: Interacts with TGFB1I1.
Protein type: Unknown function
Chromosomal Location of Human Ortholog: 14q32.3
Cellular Component: cell cortex; extracellular matrix
Molecular Function: zinc ion binding
Biological Process: hemopoiesis; positive regulation of cell proliferation
Research Articles on P52943
Similar Products
Product Notes
The P52943 crip2 (Catalog #AAA963083) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-208aa; Full Length. The amino acid sequence is listed below: MASKCPKCDK TVYFAEKVSS LGKDWHKFCL KCERCSKTLT PGGHAEHDGK PFCHKPCYAT LFGPKGVNIG GAGSYIYEKP LAEGPQVTGP IEVPAARAEE RKASGPPKGP SRASSVTTFT GEPNTCPRCS KKVYFAEKVT SLGKDWHRPC LRCERCGKTL TPGGHAEHDG QPYCHKPCYG ILFGPKGVNT GAVGSYIYDR DPEGKVQP. It is sometimes possible for the material contained within the vial of "Cysteine-rich protein 2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
