Carboxypeptidase A1 (Cpa1) Recombinant Protein | Cpa1 recombinant protein
Recombinant Mouse Carboxypeptidase A1 (Cpa1)
Gene Names
Cpa1; Cpa; 0910001L12Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Carboxypeptidase A1 (Cpa1); Recombinant Mouse Carboxypeptidase A1 (Cpa1); Cpa1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
111-419, full length protein
Sequence
ALSTDAFNYATYHTLDEIYEFMDLLVTEHPQLVSKIQIGSTFEGRPINVLKFSTGGTNRPAIWIDTGIHSREWVTQASGVWFAKKITKDYGQEPTLTAILDNMDIFLEIVTNPDGFVYTHKTNRMWRKTRSHTEGSLCVGVDPNRNWDAAFGMPGASSNPCSETYRGKFPNSEVEVKSIVDFVTSHGNIKAFISIHSYSQLLLYPYGYTSEPAPDKEELDQLAKSAVTALTSLHGTKFKYGSIIDTIYQASGSTIDWTYSQGIKYSFTFELRDTGLRGFLLPASQIIPTAEETWLALLTIMDHTVKHPY
Sequence Length
309
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Cpa1 recombinant protein
Three different forms of human pancreatic procarboxypeptidase A have been isolated. This gene encodes a monomeric pancreatic exopeptidase involved in zymogen inhibition.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47,385 Da
NCBI Official Full Name
carboxypeptidase A1 preproprotein
NCBI Official Synonym Full Names
carboxypeptidase A1, pancreatic
NCBI Official Symbol
Cpa1
NCBI Official Synonym Symbols
Cpa; 0910001L12Rik
NCBI Protein Information
carboxypeptidase A1
UniProt Protein Name
Carboxypeptidase A1
Protein Family
UniProt Gene Name
Cpa1
NCBI Description
This gene encodes carboxypeptidase A, a zinc-dependent metalloprotease that cleaves peptide bonds at the C-terminus of protein substrates. The encoded preproprotein undergoes proteolytic activation to generate a mature, functional enzyme. This gene is expressed in pancreas, the encoded protein is a major component of digestive enzymes secreted by pancreas and plays an important role in the process of digestion. This gene is located in a cluster of related carboxypeptidase genes on chromosome 6. [provided by RefSeq, Jan 2016]
Uniprot Description
Carboxypeptidase that catalyzes the release of a C-terminal amino acid, but has little or no action with -Asp, -Glu, -Arg, -Lys or -Pro.
Research Articles on Cpa1
Similar Products
Product Notes
The Cpa1 cpa1 (Catalog #AAA1404259) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 111-419, full length protein. The amino acid sequence is listed below: ALSTDAFNYA TYHTLDEIYE FMDLLVTEHP QLVSKIQIGS TFEGRPINVL KFSTGGTNRP AIWIDTGIHS REWVTQASGV WFAKKITKDY GQEPTLTAIL DNMDIFLEIV TNPDGFVYTH KTNRMWRKTR SHTEGSLCVG VDPNRNWDAA FGMPGASSNP CSETYRGKFP NSEVEVKSIV DFVTSHGNIK AFISIHSYSQ LLLYPYGYTS EPAPDKEELD QLAKSAVTAL TSLHGTKFKY GSIIDTIYQA SGSTIDWTYS QGIKYSFTFE LRDTGLRGFL LPASQIIPTA EETWLALLTI MDHTVKHPY. It is sometimes possible for the material contained within the vial of "Carboxypeptidase A1 (Cpa1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
