Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Cytochrome c oxidase subunit 7A-related protein, mitochondrial (Cox7a2l) Recombinant Protein | Cox7a2l recombinant protein

Recombinant Mouse Cytochrome c oxidase subunit 7A-related protein, mitochondrial (Cox7a2l)

Gene Names
Cox7a2l; EB1; SIG81; COX7AR; COX7RP; SIG-81; Silg81
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cytochrome c oxidase subunit 7A-related protein; mitochondrial (Cox7a2l); Recombinant Mouse Cytochrome c oxidase subunit 7A-related protein; Cox7a2l recombinant protein
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
55-111, full length protein
Sequence
GKNKVPELQKFFQKADGFHLKRGLPDQMLYRTTMALTLGGTIYCLIALYMASQPRNK
Sequence Length
57
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Cox7a2l recombinant protein
Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein similar to polypeptides 1 and 2 of subunit VIIa in the C-terminal region, and also highly similar to the mouse Sig81 protein sequence. This gene is expressed in all tissues, and upregulated in a breast cancer cell line after estrogen treatment. It is possible that this gene represents a regulatory subunit of COX and mediates the higher level of energy production in target cells by estrogen.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12,399 Da
NCBI Official Full Name
cytochrome c oxidase subunit 7A-related protein, mitochondrial isoform 2
NCBI Official Synonym Full Names
cytochrome c oxidase subunit VIIa polypeptide 2-like
NCBI Official Symbol
Cox7a2l
NCBI Official Synonym Symbols
EB1; SIG81; COX7AR; COX7RP; SIG-81; Silg81
NCBI Protein Information
cytochrome c oxidase subunit 7A-related protein, mitochondrial
UniProt Protein Name
Cytochrome c oxidase subunit 7A-related protein, mitochondrial
UniProt Gene Name
Cox7a2l
UniProt Synonym Gene Names
; SIG-81

Uniprot Description

Involved in the regulation of oxidative phosphorylation and energy metabolism (PubMed:23857330, PubMed:23812712). Necessary for the assembly of mitochondrial respiratory supercomplex (PubMed:23857330, PubMed:23812712).

Research Articles on Cox7a2l

Similar Products

Product Notes

The Cox7a2l cox7a2l (Catalog #AAA1371527) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 55-111, full length protein. The amino acid sequence is listed below: GKNKVPELQK FFQKADGFHL KRGLPDQMLY RTTMALTLGG TIYCLIALYM ASQPRNK. It is sometimes possible for the material contained within the vial of "Cytochrome c oxidase subunit 7A-related protein, mitochondrial (Cox7a2l), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual