Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

COVID 19 Nucleocapsid (NP) (NP-FL) Coronavirus Recombinant Protein | COVID-19 recombinant protein

SARS-CoV-2 (2019-nCoV) Nucleocapsid Protein (NP-FL) (His Tag) (E. coli)

Purity
>95% as determined by SDS-PAGE
Affinity purification chromatography.
Synonyms
COVID 19 Nucleocapsid (NP) (NP-FL) Coronavirus; SARS-CoV-2 (2019-nCoV) Nucleocapsid Protein (NP-FL) (His Tag) (E. coli); 2019 Novel Coronavirus; Coronavirus; CoV; COVID-19 virus; HCoV-2; Human Coronavirus 2019; SARS2; SARS-CoV-2; Severe acute respiratory syndrome coronavirus 2; Nucleocapsid; Nucleoprotein (NP); COVID-19 recombinant protein
Ordering
For Research Use Only!
Host
Escherichia coli
Source: SARS-CoV-2 (2019-nCoV)
Purity/Purification
>95% as determined by SDS-PAGE
Affinity purification chromatography.
Form/Format
Liquid in sterile PBS, pH7.4.
Sequence
MHHHHHHMSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKEDLKFPRGQG
Reconstitution
According to the application
Dry Ice Shipment
Extra charge fee may add to your shipping cost as dry ice is required to ship this product.
Preparation and Storage
Recombinant proteins are shipped on dry ice. Store at <= -20°C.
Related Product Information for COVID-19 recombinant protein
Description:
A DNA sequence encoding the SARS-CoV-2 (2019-nCoV) nucleocapsid protein was expressed with His-tag in N terminus. Mol Mass: The NP-FL of SARS-CoV-2 (2019-nCoV) nucleocapsid consists of 419 amino acids.

Background:
Nucleocapsid protein is a most abundant protein of coronavirus. During virion assembly, N protein binds to viral RNA and leads to formation of the helical nucleocapsid. Nucleocapsid protein is a highly immunogenic phosphoprotein also implicated in viral genome replication and in modulating cell signaling pathways.

Similar Products

Product Notes

The COVID-19 (Catalog #AAA8574830) is a Recombinant Protein produced from Escherichia coli Source: SARS-CoV-2 (2019-nCoV) and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MHHHHHHMSD NGPQNQRNAP RITFGGPSDS TGSNQNGERS GARSKQRRPQ GLPNNTASWF TALTQHGKED LKFPRGQG. It is sometimes possible for the material contained within the vial of "COVID 19 Nucleocapsid (NP) (NP-FL) Coronavirus, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.