Coatomer subunit epsilon-1 (COPE1) Recombinant Protein | COPE1 recombinant protein
Recombinant Oryza sativa subsp. japonica Coatomer subunit epsilon-1 (COPE1)
Gene Names
LOC4336967; cope1; OsJ_015440
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Coatomer subunit epsilon-1 (COPE1); Recombinant Oryza sativa subsp. japonica Coatomer subunit epsilon-1 (COPE1); COPE1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-287, Full length protein
Sequence
MASPDLLFNLRNLFYLGAYQAAINNSDVPGLDADAAAERDAIVFRSYVALGSYQLVISEIDSSAATSLQAVKLLALYLSGDKESAIVSLKEWLSDSAVGSNPVLRLIAGIIFMHEQDYTEALKHTHSGGTLDLHALNVQIFIKMHRSDYAEKQLKIMQQIDEDHTLTQLANAWLDIAVGGSKIREAYLIFQDFAEKYPMTGMVLNGKAVCCMHMGSFDEAETLLLEALNKDAKDPETLANLIVCNLHLGKPSSRYLSQLKLSHPDHVLVKRAVSAEDNFERALQAVA
Sequence Length
287
Species
Oryza sativa subsp. japonica (Rice)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
31,581 Da
NCBI Official Full Name
coatomer subunit epsilon-1
NCBI Official Symbol
LOC4336967
NCBI Official Synonym Symbols
cope1; OsJ_015440
NCBI Protein Information
coatomer subunit epsilon-1
UniProt Protein Name
Coatomer subunit epsilon-1
UniProt Gene Name
COPE1
UniProt Synonym Gene Names
Epsilon-COP 1
Uniprot Description
The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. The coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins ().
Similar Products
Product Notes
The COPE1 cope1 (Catalog #AAA1284202) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-287, Full length protein. The amino acid sequence is listed below: MASPDLLFNL RNLFYLGAYQ AAINNSDVPG LDADAAAERD AIVFRSYVAL GSYQLVISEI DSSAATSLQA VKLLALYLSG DKESAIVSLK EWLSDSAVGS NPVLRLIAGI IFMHEQDYTE ALKHTHSGGT LDLHALNVQI FIKMHRSDYA EKQLKIMQQI DEDHTLTQLA NAWLDIAVGG SKIREAYLIF QDFAEKYPMT GMVLNGKAVC CMHMGSFDEA ETLLLEALNK DAKDPETLAN LIVCNLHLGK PSSRYLSQLK LSHPDHVLVK RAVSAEDNFE RALQAVA. It is sometimes possible for the material contained within the vial of "Coatomer subunit epsilon-1 (COPE1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
