Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Collagen alpha-1 (IX) chain (Col9a1) Recombinant Protein | Col9a1 recombinant protein

Recombinant Rat Collagen alpha-1 (IX) chain (Col9a1)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Collagen alpha-1 (IX) chain (Col9a1); Recombinant Rat Collagen alpha-1 (IX) chain (Col9a1); Col9a1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-325, Full length protein
Sequence
PGQLGNSGKPGQQGPPGEVGPRGPRGLPGSRGPVGPEGSPGIPGKLGPLGSPGLPGLPGPPGLPGMKGDRGVFGEPGPKGEQGASGEEGEAGVRGDLGDMGQPGPKGSVGNPGEPGLRGPEGIRGLPGVEGPRGPPGPRGVQGEQGATGLPGIQGPPGRAPTDQHIKQVCMRVVQEHFAEMAASLKRPDTGASGLPGRPGPPGPPGPPGENGFPGQMGIRGLPGIKGPPGALGLRGPKGDLGEKGERGPPGRGPKGLPGAIGLPGDPGPASYGKNGRDGEQGPPGVAGIPGVPGPPGPPGPPGFCEPASCTLQAGQRAFSKGPDK
Sequence Length
325
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Col9a1 recombinant protein
This gene encodes one of the three alpha chains of type IX collagen, which is a minor (5-20%) collagen component of hyaline cartilage. Type IX collagen is usually found in tissues containing type II collagen, a fibrillar collagen. Studies in knockout mice have shown that synthesis of the alpha 1 chain is essential for assembly of type IX collagen molecules, a heterotrimeric molecule, and that lack of type IX collagen is associated with early onset osteoarthritis. Mutations in this gene are associated with osteoarthritis in humans, with multiple epiphyseal dysplasia, 6, a form of chondrodysplasia, and with Stickler syndrome, a disease characterized by ophthalmic, orofacial, articular, and auditory defects. Two transcript variants that encode different isoforms have been identified for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
31,256 Da
NCBI Official Full Name
Collagen alpha-1(IX) chain
NCBI Official Synonym Full Names
collagen type IX alpha 1 chain
NCBI Official Symbol
Col9a1
NCBI Protein Information
collagen alpha-1(IX) chain
UniProt Protein Name
Collagen alpha-1(IX) chain
Protein Family
UniProt Gene Name
Col9a1

Uniprot Description

Structural component of hyaline cartilage and vitreous of the eye.

Research Articles on Col9a1

Similar Products

Product Notes

The Col9a1 col9a1 (Catalog #AAA965254) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-325, Full length protein. The amino acid sequence is listed below: PGQLGNSGKP GQQGPPGEVG PRGPRGLPGS RGPVGPEGSP GIPGKLGPLG SPGLPGLPGP PGLPGMKGDR GVFGEPGPKG EQGASGEEGE AGVRGDLGDM GQPGPKGSVG NPGEPGLRGP EGIRGLPGVE GPRGPPGPRG VQGEQGATGL PGIQGPPGRA PTDQHIKQVC MRVVQEHFAE MAASLKRPDT GASGLPGRPG PPGPPGPPGE NGFPGQMGIR GLPGIKGPPG ALGLRGPKGD LGEKGERGPP GRGPKGLPGA IGLPGDPGPA SYGKNGRDGE QGPPGVAGIP GVPGPPGPPG PPGFCEPASC TLQAGQRAFS KGPDK. It is sometimes possible for the material contained within the vial of "Collagen alpha-1 (IX) chain (Col9a1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.