Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Collagen alpha-2 (VIII) chain (COL8A2) Recombinant Protein | COL8A2 recombinant protein

Recombinant Human Collagen alpha-2 (VIII) chain (COL8A2)

Gene Names
COL8A2; FECD; PPCD; FECD1; PPCD2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Collagen alpha-2 (VIII) chain (COL8A2); Recombinant Human Collagen alpha-2 (VIII) chain (COL8A2); COL8A2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
29-703, Full length protein
Sequence
GGGAGGAAGYAPVKYIQPMQKGPVGPPFREGKGQYLEMPLPLLPMDLKGEPGPPGKPGPRGPPGPPGFPGKPGMGKPGLHGQPGPAGPPGFSRMGKAGPPGLPGKVGPPGQPGLRGEPGIRGDQGLRGPPGPPGLPGPSGITIPGKPGAQGVPGPPGFQGEPGPQGEPGPPGDRGLKGDNGVGQPGLPGAPGQGGAPGPPGLPGPAGLGKPGLDGLPGAPGDKGESGPPGVPGPRGEPGAVGPKGPPGVDGVGVPGAAGLPGPQGPSGAKGEPGTRGPPGLIGPTGYGMPGLPGPKGDRGPAGVPGLLGDRGEPGEDGEPGEQGPQGLGGPPGLPGSAGLPGRRGPPGPKGEAGPGGPPGVPGIRGDQGPSGLAGKPGVPGERGLPGAHGPPGPTGPKGEPGFTGRPGGPGVAGALGQKGDLGLPGQPGLRGPSGIPGLQGPAGPIGPQGLPGLKGEPGLPGPPGEGRAGEPGTAGPTGPPGVPGSPGITGPPGPPGPPGPPGAPGAFDETGIAGLHLPNGGVEGAVLGKGGKPQFGLGELSAHATPAFTAVLTSPFPASGMPVKFDRTLYNGHSGYNPATGIFTCPVGGVYYFAYHVHVKGTNVWVALYKNNVPATYTYDEYKKGYLDQASGGAVLQLRPNDQVWVQMPSDQANGLYSTEYIHSSFSGFLLCPT
Sequence Length
675
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for COL8A2 recombinant protein
This gene encodes the alpha 2 chain of type VIII collagen. The protein is a major component of the basement membrane of the corneal endothelium and forms homo- or heterotrimers with alpha 1 (VIII) type collagens. Defects in this gene are associated with Fuchs endothelial corneal dystrophy and posterior polymorphous corneal dystrophy type 2.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67,244 Da
NCBI Official Full Name
collagen alpha-2(VIII) chain isoform 2
NCBI Official Synonym Full Names
collagen type VIII alpha 2 chain
NCBI Official Symbol
COL8A2
NCBI Official Synonym Symbols
FECD; PPCD; FECD1; PPCD2
NCBI Protein Information
collagen alpha-2(VIII) chain
UniProt Protein Name
Collagen alpha-2(VIII) chain
UniProt Gene Name
COL8A2

NCBI Description

This gene encodes the alpha 2 chain of type VIII collagen. This protein is a major component of the basement membrane of the corneal endothelium and forms homo- or heterotrimers with alpha 1 (VIII) type collagens. Defects in this gene are associated with Fuchs endothelial corneal dystrophy and posterior polymorphous corneal dystrophy type 2. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2014]

Uniprot Description

Macromolecular component of the subendothelium. Major component of the Descemet's membrane (basement membrane) of corneal endothelial cells. Also component of the endothelia of blood vessels. Necessary for migration and proliferation of vascular smooth muscle cells and thus, has a potential role in the maintenance of vessel wall integrity and structure, in particular in atherogenesis ().

Research Articles on COL8A2

Similar Products

Product Notes

The COL8A2 col8a2 (Catalog #AAA966818) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 29-703, Full length protein. The amino acid sequence is listed below: GGGAGGAAGY APVKYIQPMQ KGPVGPPFRE GKGQYLEMPL PLLPMDLKGE PGPPGKPGPR GPPGPPGFPG KPGMGKPGLH GQPGPAGPPG FSRMGKAGPP GLPGKVGPPG QPGLRGEPGI RGDQGLRGPP GPPGLPGPSG ITIPGKPGAQ GVPGPPGFQG EPGPQGEPGP PGDRGLKGDN GVGQPGLPGA PGQGGAPGPP GLPGPAGLGK PGLDGLPGAP GDKGESGPPG VPGPRGEPGA VGPKGPPGVD GVGVPGAAGL PGPQGPSGAK GEPGTRGPPG LIGPTGYGMP GLPGPKGDRG PAGVPGLLGD RGEPGEDGEP GEQGPQGLGG PPGLPGSAGL PGRRGPPGPK GEAGPGGPPG VPGIRGDQGP SGLAGKPGVP GERGLPGAHG PPGPTGPKGE PGFTGRPGGP GVAGALGQKG DLGLPGQPGL RGPSGIPGLQ GPAGPIGPQG LPGLKGEPGL PGPPGEGRAG EPGTAGPTGP PGVPGSPGIT GPPGPPGPPG PPGAPGAFDE TGIAGLHLPN GGVEGAVLGK GGKPQFGLGE LSAHATPAFT AVLTSPFPAS GMPVKFDRTL YNGHSGYNPA TGIFTCPVGG VYYFAYHVHV KGTNVWVALY KNNVPATYTY DEYKKGYLDQ ASGGAVLQLR PNDQVWVQMP SDQANGLYST EYIHSSFSGF LLCPT. It is sometimes possible for the material contained within the vial of "Collagen alpha-2 (VIII) chain (COL8A2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.