Collagen alpha-1 (VIII) chain (COL8A1) Recombinant Protein | COL8A1 recombinant protein

Recombinant Human Collagen alpha-1 (VIII) chain (COL8A1)

Cat. Num. AAA958828

• Gene Names: COL8A1; C3orf7
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Collagen alpha-1 (VIII) chain (COL8A1); Recombinant Human Collagen alpha-1 (VIII) chain (COL8A1); COL8A1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 572-744aa; Partial(Vastatin Chain)
• Sequence: AVMPPTPPPQGEYLPDMGLGIDGVKPPHAYGAKKGKNGGPAYEMPAFTAELTAPFPPVGAPVKFNKLLYNGRQNYNPQTGIFTCEVPGVYYFAYHVHCKGGNVWVALFKNNEPVMYTYDEYKKGFLDQASGSAVLLLRPGDRVFLQMPSEQAAGLYAGQYVHSSFSGYLLYPM

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for COL8A1 recombinant protein

This gene encodes one of the two alpha chains of type VIII collagen. The gene product is a short chain collagen and a major component of the basement membrane of the corneal endothelium. The type VIII collagen fibril can be either a homo- or a heterotrimer. Alternatively spliced transcript variants encoding the same isoform have been observed.

NCBI and Uniprot Product Information

• NCBI GI #: 17738302
• NCBI GeneID: 1295
• NCBI Accession #: NP_001841.2
• NCBI GenBank Nucleotide #: NM_001850.4
• UniProt Accession #: P27658; Q53XI6; Q96D07; D3DN42
• Molecular Weight: 73,364 Da
• NCBI Official Full Name: collagen alpha-1(VIII) chain
• NCBI Official Synonym Full Names: collagen type VIII alpha 1 chain
• NCBI Official Symbol: COL8A1
• NCBI Official Synonym Symbols: C3orf7
• NCBI Protein Information: collagen alpha-1(VIII) chain
• UniProt Protein Name: Collagen alpha-1(VIII) chain
• Protein Family: Collagen
• UniProt Gene Name: COL8A1
• UniProt Synonym Gene Names: C3orf7

NCBI Description

This gene encodes one of the two alpha chains of type VIII collagen. The gene product is a short chain collagen and a major component of the basement membrane of the corneal endothelium. The type VIII collagen fibril can be either a homo- or a heterotrimer. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq, Dec 2011]

Uniprot Description

Macromolecular component of the subendothelium. Major component of the Descemet's membrane (basement membrane) of corneal endothelial cells. Also component of the endothelia of blood vessels. Necessary for migration and proliferation of vascular smooth muscle cells and thus, has a potential role in the maintenance of vessel wall integrity and structure, in particular in atherogenesis.