Collagen alpha-3 (VI) chain (COL6A3) Recombinant Protein | COL6A3 recombinant protein
Recombinant Chicken Collagen alpha-3 (VI) chain (COL6A3), partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Collagen alpha-3 (VI) chain (COL6A3); Recombinant Chicken Collagen alpha-3 (VI) chain (COL6A3); partial; COL6A3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2964-3137. Partial, including the BPTI/Kunitz inhibitor Domain
Sequence
TDVTENSARLRWASPEPHNAYVFDLAITLAHDHSLVLKQNVTGTERVIGGLRSGQKYLVFITGYLKSQPKVTYTGTFSTKTPAQPKVALANMMLNAEPLEGPENVMDICLLQKEEGTCRDFVLKWHYDLKTKSCARFWYGGCGGNENRFNTQKECEKACSPGNISPGVVTTIGT
Sequence Length
3137
Species
Chicken
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for COL6A3 recombinant protein
This gene encodes the alpha-3 chain, one of the three alpha chains of type VI collagen, a beaded filament collagen found in most connective tissues. The alpha-3 chain of type VI collagen is much larger than the alpha-1 and -2 chains. This difference in size is largely due to an increase in the number of subdomains, similar to von Willebrand Factor type A domains, that are found in the amino terminal globular domain of all the alpha chains. These domains have been shown to bind extracellular matrix proteins, an interaction that explains the importance of this collagen in organizing matrix components. Mutations in the type VI collagen genes are associated with Bethlem myopathy, a rare autosomal dominant proximal myopathy with early childhood onset. Mutations in this gene are also a cause of Ullrich congenital muscular dystrophy, also referred to as Ullrich scleroatonic muscular dystrophy, an autosomal recessive congenital myopathy that is more severe than Bethlem myopathy. Multiple transcript variants have been identified, but the full-length nature of only some of these variants has been described.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
339,599 Da
NCBI Official Full Name
Collagen alpha-3(VI) chain
NCBI Official Synonym Full Names
collagen type VI alpha 3 chain
NCBI Official Symbol
COL6A3
NCBI Protein Information
collagen alpha-3(VI) chain
UniProt Protein Name
Collagen alpha-3(VI) chain
Protein Family
UniProt Gene Name
COL6A3
Uniprot Description
Collagen VI acts as a cell-binding protein.
Similar Products
Product Notes
The COL6A3 col6a3 (Catalog #AAA951590) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2964-3137. Partial, including the BPTI/Kunitz inhibitor Domain. The amino acid sequence is listed below: TDVTENSARL RWASPEPHNA YVFDLAITLA HDHSLVLKQN VTGTERVIGG LRSGQKYLVF ITGYLKSQPK VTYTGTFSTK TPAQPKVALA NMMLNAEPLE GPENVMDICL LQKEEGTCRD FVLKWHYDLK TKSCARFWYG GCGGNENRFN TQKECEKACS PGNISPGVVT TIGT . It is sometimes possible for the material contained within the vial of "Collagen alpha-3 (VI) chain (COL6A3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
