Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ATAD1Sample Type: Uterus TumorAntibody Dilution: 1.0ug/ml)

Rabbit ATAD1 Polyclonal Antibody | anti-ATAD1 antibody

ATAD1 Antibody - N-terminal region

Gene Names
ATAD1; AFDC1; HKPX4; FNP001; THORASE
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity purified
Synonyms
ATAD1; Polyclonal Antibody; ATAD1 Antibody - N-terminal region; anti-ATAD1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FRLTIFGAVTYFTIKWMVDAIDPTRKQKVEAQKQAEKLMKQIGVKNVKLS
Sequence Length
287
Applicable Applications for anti-ATAD1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ATAD1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ATAD1Sample Type: Uterus TumorAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ATAD1Sample Type: Uterus TumorAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ATAD1 antibody
This is a rabbit polyclonal antibody against ATAD1. It was validated on Western Blot

Target Description: ATAD1 is a ATPase that plays a critical role in regulating the surface expression of AMPA receptors (AMPAR), thereby regulating synaptic plasticity and learning and memory. Required for NMDA- stimulated AMPAR internalization and inhibition of GRIA1 and GRIA2 recycling back to the plasma membrane; these activities are ATPase-dependent.
Product Categories/Family for anti-ATAD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
31 kDa
NCBI Official Full Name
ATAD1 protein, partial
NCBI Official Synonym Full Names
ATPase family AAA domain containing 1
NCBI Official Symbol
ATAD1
NCBI Official Synonym Symbols
AFDC1; HKPX4; FNP001; THORASE
NCBI Protein Information
ATPase family AAA domain-containing protein 1
UniProt Protein Name
ATPase family AAA domain-containing protein 1
UniProt Gene Name
ATAD1
UniProt Entry Name
ATAD1_HUMAN

Uniprot Description

ATAD1: ATPase that plays a critical role in regulating the surface expression of AMPA receptors (AMPAR), thereby regulating synaptic plasticity and learning and memory. Required for NMDA- stimulated AMPAR internalization and inhibition of GRIA1 and GRIA2 recycling back to the plasma membrane; these activities are ATPase-dependent. Belongs to the AAA ATPase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Mitochondrial; Hydrolase; EC 3.6.1.3

Chromosomal Location of Human Ortholog: 10q23.31

Cellular Component: peroxisomal membrane; postsynaptic membrane; membrane; mitochondrion; cell junction; nucleus

Molecular Function: ATPase activity; microtubule-severing ATPase activity; ATP binding

Biological Process: metabolic process; positive regulation of receptor internalization; negative regulation of synaptic transmission, glutamatergic; learning; memory; cytoplasmic microtubule organization and biogenesis

Research Articles on ATAD1

Similar Products

Product Notes

The ATAD1 atad1 (Catalog #AAA3214898) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATAD1 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ATAD1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ATAD1 atad1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FRLTIFGAVT YFTIKWMVDA IDPTRKQKVE AQKQAEKLMK QIGVKNVKLS. It is sometimes possible for the material contained within the vial of "ATAD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.