Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Collagen alpha-1 (XI) chain (COL11A1) Recombinant Protein | COL11A1 recombinant protein

Recombinant Bovine Collagen alpha-1 (XI) chain (COL11A1) , partial

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Collagen alpha-1 (XI) chain (COL11A1); Recombinant Bovine Collagen alpha-1 (XI) chain (COL11A1); partial; COL11A1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
279-435. Partial.
Sequence
QEAQAQAILQQARIALRGPPGPMGLTGRPGPVGGPGSSGAKGEMGDPGPQGPRGVQGPPGPTGKPGKRGRPGADGGRGMPGEPGAKGDRGFDGLPGLPGDKGHRGERGPQGPPGPPGEDGIRGEDGEIGPRGLPGEAGPRGLLGPRGTPGPIGQPGI
Sequence Length
435
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for COL11A1 recombinant protein
This gene encodes one of the two alpha chains of type XI collagen, a minor fibrillar collagen. Type XI collagen is a heterotrimer but the third alpha chain is a post-translationally modified alpha 1 type II chain. Mutations in this gene are associated with type II Stickler syndrome and with Marshall syndrome. A single-nucleotide polymorphism in this gene is also associated with susceptibility to lumbar disc herniation. Multiple transcript variants have been identified for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
89,260 Da
NCBI Official Full Name
Collagen alpha-1(XI) chain
NCBI Official Synonym Full Names
collagen type XI alpha 1 chain
NCBI Official Symbol
COL11A1
NCBI Protein Information
collagen alpha-1(XI) chain
UniProt Protein Name
Collagen alpha-1(XI) chain
Protein Family
UniProt Gene Name
COL11A1

Uniprot Description

May play an important role in fibrillogenesis by controlling lateral growth of collagen II fibrils.

Similar Products

Product Notes

The COL11A1 col11a1 (Catalog #AAA1391998) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 279-435. Partial. The amino acid sequence is listed below: QEAQAQAILQ QARIALRGPP GPMGLTGRPG PVGGPGSSGA KGEMGDPGPQ GPRGVQGPPG PTGKPGKRGR PGADGGRGMP GEPGAKGDRG FDGLPGLPGD KGHRGERGPQ GPPGPPGEDG IRGEDGEIGP RGLPGEAGPR GLLGPRGTPG PIGQPGI . It is sometimes possible for the material contained within the vial of "Collagen alpha-1 (XI) chain (COL11A1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.