Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Ciliary neurotrophic factor Recombinant Protein | CNTF recombinant protein

Recombinant Human Ciliary neurotrophic factor protein

Gene Names
CNTF; HCNTF
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ciliary neurotrophic factor; Recombinant Human Ciliary neurotrophic factor protein; CNTF recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
4-196aa; Partial
Sequence
TEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIAN
Sequence Length
200
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for CNTF recombinant protein
CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy.
Product Categories/Family for CNTF recombinant protein
References
Recombinant human and rat ciliary neurotrophic factors.Masiakowski P., Liu H., Radziejewski C., Lottspeich F., Oberthuer W., Wong V., Lindsay R.M., Furth M.E., Panayotatos N.J. Neurochem. 57:1003-1012(1991) Cloning and expression of human ciliary neurotrophic factor.Negro A., Tolosano E., Skaper S., Martini I., Callegaro L., Silengo L., Fiorini F., Altruda F.Eur. J. Biochem. 201:289-294(1991) Sequence and structural organization of the human gene encoding ciliary neurotrophic factor.Lam A., Fuller F., Miller J., Kloss J., Manthorpe M., Varon M., Cordell B.Gene 102:271-276(1991) Expression and characterization of recombinant human ciliary neurotrophic factor from Escherichia coli.McDonald J.R., Ko C., Mismer D., Smith D.J., Collins F.Biochim. Biophys. Acta 1090:70-80(1991) A null mutation in the human CNTF gene is not causally related to neurological diseases.Takahashi R., Yokoji H., Misawa H., Hayashi M., Hu J., Deguchi T.Nat. Genet. 7:79-84(1994) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26.1 kDa
NCBI Official Full Name
ciliary neurotrophic factor
NCBI Official Synonym Full Names
ciliary neurotrophic factor
NCBI Official Symbol
CNTF
NCBI Official Synonym Symbols
HCNTF
NCBI Protein Information
ciliary neurotrophic factor
UniProt Protein Name
Ciliary neurotrophic factor
UniProt Gene Name
CNTF
UniProt Synonym Gene Names
CNTF
UniProt Entry Name
CNTF_HUMAN

NCBI Description

The protein encoded by this gene is a polypeptide hormone whose actions appear to be restricted to the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. The protein is a potent survival factor for neurons and oligodendrocytes and may be relevant in reducing tissue destruction during inflammatory attacks. A mutation in this gene, which results in aberrant splicing, leads to ciliary neurotrophic factor deficiency, but this phenotype is not causally related to neurologic disease. A read-through transcript variant composed of the upstream ZFP91 gene and CNTF sequence has been identified, but it is thought to be non-coding. Read-through transcription of ZFP91 and CNTF has also been observed in mouse. [provided by RefSeq, Oct 2010]

Uniprot Description

CNTF: CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy. Belongs to the CNTF family.

Chromosomal Location of Human Ortholog: 11q12.2

Cellular Component: cytoplasm; extracellular region; extracellular space

Molecular Function: ciliary neurotrophic factor receptor binding; growth factor activity; interleukin-6 receptor binding; protein binding

Biological Process: growth; muscle morphogenesis; negative regulation of neuron apoptosis; negative regulation of photoreceptor cell differentiation; neuron development; positive regulation of cell proliferation; positive regulation of tyrosine phosphorylation of Stat3 protein; regulation of retinal cell programmed cell death; signal transduction

Research Articles on CNTF

Similar Products

Product Notes

The CNTF cntf (Catalog #AAA957104) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 4-196aa; Partial. The amino acid sequence is listed below: TEHSPLTPHR RDLCSRSIWL ARKIRSDLTA LTESYVKHQG LNKNINLDSA DGMPVASTDQ WSELTEAERL QENLQAYRTF HVLLARLLED QQVHFTPTEG DFHQAIHTLL LQVAAFAYQI EELMILLEYK IPRNEADGMP INVGDGGLFE KKLWGLKVLQ ELSQWTVRSI HDLRFISSHQ TGIPARGSHY IAN. It is sometimes possible for the material contained within the vial of "Ciliary neurotrophic factor, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.