Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

FtsJ methyltransferase domain-containing protein 1 (FTSJD1) Recombinant Protein | FTSJD1 recombinant protein

Recombinant Pongo abelii FtsJ methyltransferase domain-containing protein 1 (FTSJD1)

Gene Names
CMTR2; MTr2; FTSJD1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
FtsJ methyltransferase domain-containing protein 1 (FTSJD1); Recombinant Pongo abelii FtsJ methyltransferase domain-containing protein 1 (FTSJD1); FTSJD1 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-769aa; full length protein
Sequence
MSKCRKTPVQQLASPTSFSPDILADIFELFAKNFSYSKPLNNEWQLPDPSEIFTCDHTEF NAFLDLKNSLNEVKNLLSDKKLDEWHEHTAFTNKAGKIISHVRKSVNAELCTQAWCKFHE ILCSFPLIPQEAFQNGKLNSLHLCEAPGAFIASLNHYLKSHRFPCHWSWVANTLNPYHEA NDDLMMIMDDRLIANTLHWWYFGPDNTGDIMTLKFLTGLQNFISSMATVHLVTADGSFDC QGNPGEQEALVSSLHYCEVVTALTTLGNGGSFVLKMFTMFEHCSINLMYLLNCCLDQVHV FKPATSKAGNSEVYVVCLYYKGREAIHPLLSKMTLNFGTEMKRKALFPHHVIPDSFLKRH EECCVFFHKYQLETISENIRLFECMGKAEQEKLNNLRDCAVQYFMQKFQLKHLSRNNWLV KKSSIGCSTNTKWFGQRNKYFRTYNERKMLEALSWKDKVAKGYFNSWAEEHGVYHPGQSS ILEGTASNLECHLWHILEGKKLPKVKCSPFCNGEILKTLNEAIEKSLGGAFNLDSKFRPK QQYSCSCHVFSEELIFSELCSLTECLQDEQVVEPSNRIKCLLVGFSTLHNIKMHIPLEVR LLESAELTTFSCSLLHDGDPTYQRLFLDCLLHSLRELHTGDVMILPVLSCFTRFMAGLIF VLHSCFRFITFFCPTSSDPLRTCAVLLCVGYQDLPNPVFQYLQSVNELLSTLLNSDSPQQ VLQFVPMEVLLKGALLDFLWDLNAAIAKRHLHFIIQREREEINSLQLQN
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Pongo abelii (Sumatran orangutan)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for FTSJD1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
88,166 Da
NCBI Official Full Name
cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 2
NCBI Official Symbol
CMTR2
NCBI Official Synonym Symbols
MTr2; FTSJD1
NCBI Protein Information
cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 2
UniProt Protein Name
Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 2
UniProt Gene Name
CMTR2
UniProt Synonym Gene Names
FTSJD1; MTr2
UniProt Entry Name
CMTR2_PONAB

Uniprot Description

S-adenosyl-L-methionine-dependent methyltransferase that mediates mRNA cap2 2'-O-ribose methylation to the 5'-cap structure of mRNAs. Methylates the ribose of the second nucleotide of a m7GpppG-capped mRNA and small nuclear RNA (snRNA) (cap0) to produce m7GpppRmpNm (cap2). Recognizes a guanosine cap on RNA independently of its N7 methylation status. Display cap2 methylation on both cap0 and cap1. Displays a preference for cap1 RNAs.

Similar Products

Product Notes

The FTSJD1 cmtr2 (Catalog #AAA7015299) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-769aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the FTSJD1 cmtr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSKCRKTPVQ QLASPTSFSP DILADIFELF AKNFSYSKPL NNEWQLPDPS EIFTCDHTEF NAFLDLKNSL NEVKNLLSDK KLDEWHEHTA FTNKAGKIIS HVRKSVNAEL CTQAWCKFHE ILCSFPLIPQ EAFQNGKLNS LHLCEAPGAF IASLNHYLKS HRFPCHWSWV ANTLNPYHEA NDDLMMIMDD RLIANTLHWW YFGPDNTGDI MTLKFLTGLQ NFISSMATVH LVTADGSFDC QGNPGEQEAL VSSLHYCEVV TALTTLGNGG SFVLKMFTMF EHCSINLMYL LNCCLDQVHV FKPATSKAGN SEVYVVCLYY KGREAIHPLL SKMTLNFGTE MKRKALFPHH VIPDSFLKRH EECCVFFHKY QLETISENIR LFECMGKAEQ EKLNNLRDCA VQYFMQKFQL KHLSRNNWLV KKSSIGCSTN TKWFGQRNKY FRTYNERKML EALSWKDKVA KGYFNSWAEE HGVYHPGQSS ILEGTASNLE CHLWHILEGK KLPKVKCSPF CNGEILKTLN EAIEKSLGGA FNLDSKFRPK QQYSCSCHVF SEELIFSELC SLTECLQDEQ VVEPSNRIKC LLVGFSTLHN IKMHIPLEVR LLESAELTTF SCSLLHDGDP TYQRLFLDCL LHSLRELHTG DVMILPVLSC FTRFMAGLIF VLHSCFRFIT FFCPTSSDPL RTCAVLLCVG YQDLPNPVFQ YLQSVNELLS TLLNSDSPQQ VLQFVPMEVL LKGALLDFLW DLNAAIAKRH LHFIIQRERE EINSLQLQN. It is sometimes possible for the material contained within the vial of "FtsJ methyltransferase domain-containing protein 1 (FTSJD1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.