Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (VAV1 monoclonal antibody (M03), clone 2C11 Western Blot analysis of VAV1 expression in Jurkat (Cat # L017V1).)

Mouse VAV1 Monoclonal Antibody | anti-VAV1 antibody

VAV1 (Vav 1 Guanine Nucleotide Exchange Factor, VAV) (HRP)

Gene Names
VAV1; VAV
Applications
Western Blot
Purity
Purified
Synonyms
VAV1; Monoclonal Antibody; VAV1 (Vav 1 Guanine Nucleotide Exchange Factor; VAV) (HRP); Vav 1 Guanine Nucleotide Exchange Factor; VAV; anti-VAV1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2C11
Specificity
Recognizes VAV1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
790
Applicable Applications for anti-VAV1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
VAV1 (AAH13361, 681aa-790aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISRPAVGSTKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEEDYSEYC
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(VAV1 monoclonal antibody (M03), clone 2C11 Western Blot analysis of VAV1 expression in Jurkat (Cat # L017V1).)

Western Blot (WB) (VAV1 monoclonal antibody (M03), clone 2C11 Western Blot analysis of VAV1 expression in Jurkat (Cat # L017V1).)

Testing Data

(Detection limit for recombinant GST tagged VAV1 is approximately 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged VAV1 is approximately 0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-VAV1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
VAV1 protein
NCBI Official Synonym Full Names
vav guanine nucleotide exchange factor 1
NCBI Official Symbol
VAV1
NCBI Official Synonym Symbols
VAV
NCBI Protein Information
proto-oncogene vav
Protein Family

NCBI Description

This gene is a member of the VAV gene family. The VAV proteins are guanine nucleotide exchange factors (GEFs) for Rho family GTPases that activate pathways leading to actin cytoskeletal rearrangements and transcriptional alterations. The encoded protein is important in hematopoiesis, playing a role in T-cell and B-cell development and activation. The encoded protein has been identified as the specific binding partner of Nef proteins from HIV-1. Coexpression and binding of these partners initiates profound morphological changes, cytoskeletal rearrangements and the JNK/SAPK signaling cascade, leading to increased levels of viral transcription and replication. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Apr 2012]

Research Articles on VAV1

Similar Products

Product Notes

The VAV1 (Catalog #AAA6180479) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's VAV1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the VAV1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "VAV1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.