ATP-dependent Clp protease proteolytic subunit-related protein 3, chloroplastic (CLPR3) Recombinant Protein | CLPR3 recombinant protein

Recombinant Arabidopsis thaliana ATP-dependent Clp protease proteolytic subunit-related protein 3, chloroplastic (CLPR3)

Gene Names

AT1G09130; F7G19.1; F7G19_1

Purity

Greater or equal to 85% purity as determined by SDS-PAGE.

Synonyms

ATP-dependent Clp protease proteolytic subunit-related protein 3; chloroplastic (CLPR3); Recombinant Arabidopsis thaliana ATP-dependent Clp protease proteolytic subunit-related protein 3; CLPR3 recombinant protein

Ordering
Cat. Num. AAA1403410 When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures. For Research Use Only!

Host

E Coli or Yeast or Baculovirus or Mammalian Cell

Purity/Purification

Greater or equal to 85% purity as determined by SDS-PAGE.

Form/Format

Lyophilized or liquid (Format to be determined during the manufacturing process)

Sequence Positions

44-330, Full length protein

Sequence

AKASAKIPMPPINPKDPFLSTLASIAANSPEKLLNRPVNADVPPYLDIFDSPQLMSSPAQVERSVAYNEHRPRTPPPDLPSMLLDGRIVYIGMPLVPAVTELVVAELMYLQWLDPKEPIYIYINSTGTTRDDGETVGMESEGFAIYDSLMQLKNEVHTVCVGAAIGQACLLLSAGTKGKRFMMPHAKAMIQQPRVPSSGLMPASDVLIRAKEVITNRDILVELLSKHTGNSVETVANVMRRPYYMDAPKAKEFGVIDRILWRGQEKIIADVVPSEEFDKNAGIKSVV

Sequence Length

287

Species

Arabidopsis thaliana (Mouse-ear cress)

Preparation and Storage

Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #

79317437

NCBI GeneID

837432

NCBI Accession #

NP_001031008.1

NCBI GenBank Nucleotide #

NM_001035931.2

UniProt Accession #

Q8L770; O04018; Q67XY5; Q680D2

Molecular Weight

36,307 Da

NCBI Official Full Name

ATP-dependent caseinolytic (Clp) protease/crotonase family protein

NCBI Official Symbol

AT1G09130

NCBI Official Synonym Symbols

F7G19.1; F7G19_1

NCBI Protein Information

ATP-dependent caseinolytic (Clp) protease/crotonase family protein

UniProt Protein Name

ATP-dependent Clp protease proteolytic subunit-related protein 3, chloroplastic

Protein Family

ATP-dependent Clp protease proteolytic subunit-related protein

UniProt Gene Name

CLPR3

UniProt Synonym Gene Names

ClpR3

Similar Products

Product Notes

The CLPR3 clpr3 (Catalog #AAA1403410) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 44-330, Full length protein. The amino acid sequence is listed below: AKASAKIPMP PINPKDPFLS TLASIAANSP EKLLNRPVNA DVPPYLDIFD SPQLMSSPAQ VERSVAYNEH RPRTPPPDLP SMLLDGRIVY IGMPLVPAVT ELVVAELMYL QWLDPKEPIY IYINSTGTTR DDGETVGMES EGFAIYDSLM QLKNEVHTVC VGAAIGQACL LLSAGTKGKR FMMPHAKAMI QQPRVPSSGL MPASDVLIRA KEVITNRDIL VELLSKHTGN SVETVANVMR RPYYMDAPKA KEFGVIDRIL WRGQEKIIAD VVPSEEFDKN AGIKSVV. It is sometimes possible for the material contained within the vial of "ATP-dependent Clp protease proteolytic subunit-related protein 3, chloroplastic (CLPR3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Loading...