Creatine kinase S-type, mitochondrial (CKMT2) Recombinant Protein | CKMT2 recombinant protein

Recombinant Human Creatine kinase S-type, mitochondrial (CKMT2)

Cat. Num. AAA949065

• Gene Names: CKMT2; SMTCK
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Creatine kinase S-type; mitochondrial (CKMT2); Recombinant Human Creatine kinase S-type; CKMT2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 40-419, Full length protein
• Sequence: EVREQPRLFPPSADYPDLRKHNNCMAECLTPAIYAKLRNKVTPNGYTLDQCIQTGVDNPGHPFIKTVGMVAGDEESYEVFADLFDPVIKLRHNGYDPRVMKHTTDLDASKITQGQFDEHYVLSSRVRTGRSIRGLSLPPACTRAERREVENVAITALEGLKGDLAGRYYKLSEMTEQDQQRLIDDHFLFDKPVSPLLTCAGMARDWPDARGIWHNYDKTFLIWINEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHVRIPKLSKDPRFSKILENLRLQKRGTGGVDTAAVADVYDISNIDRIGRSEVELVQIVIDGVNYLVDCEKKLERGQDIKVPPPLPQFGKK
• Sequence Length: 380

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for CKMT2 recombinant protein

Mitochondrial creatine kinase (MtCK) is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Sarcomeric mitochondrial creatine kinase has 80% homology with the coding exons of ubiquitous mitochondrial creatine kinase. This gene contains sequences homologous to several motifs that are shared among some nuclear genes encoding mitochondrial proteins and thus may be essential for the coordinated activation of these genes during mitochondrial biogenesis. Three transcript variants encoding the same protein have been found for this gene.

NCBI and Uniprot Product Information

• NCBI GI #: 153251984
• NCBI GeneID: 1160
• NCBI Accession #: NP_001093205.1
• NCBI GenBank Nucleotide #: NM_001099735.1
• UniProt Accession #: P17540; Q6ICS8; Q8N1E1
• Molecular Weight: 47,504 Da
• NCBI Official Full Name: creatine kinase S-type, mitochondrial
• NCBI Official Synonym Full Names: creatine kinase, mitochondrial 2
• NCBI Official Symbol: CKMT2
• NCBI Official Synonym Symbols: SMTCK
• NCBI Protein Information: creatine kinase S-type, mitochondrial
• UniProt Protein Name: Creatine kinase S-type, mitochondrial
• Protein Family: Creatine kinase
• UniProt Gene Name: CKMT2
• UniProt Synonym Gene Names: Mib-CK; S-MtCK

NCBI Description

Mitochondrial creatine kinase (MtCK) is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Sarcomeric mitochondrial creatine kinase has 80% homology with the coding exons of ubiquitous mitochondrial creatine kinase. This gene contains sequences homologous to several motifs that are shared among some nuclear genes encoding mitochondrial proteins and thus may be essential for the coordinated activation of these genes during mitochondrial biogenesis. Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa.