Rabbit CKMT2 Polyclonal Antibody | anti-CKMT2 antibody

CKMT2 Rabbit pAb

Cat. Num. AAA9142026

• Gene Names: CKMT2; SMTCK
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot
• Purity: Affinity purification
• Synonyms: CKMT2; Polyclonal Antibody; CKMT2 Rabbit pAb; SMTCK; anti-CKMT2 antibody

• Host: Rabbit
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity purification
• Form/Format: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Sequence: EVREQPRLFPPSADYPDLRKHNNCMAECLTPAIYAKLRNKVTPNGYTLDQCIQTGVDNPGHPFIKTVGMVAGDEESYEVFADLFDPVIKLRHNGYDPRVMKHTTDLDASKITQGQFDEHYVLSSRVRTGRSIRGLSLPPACTRAERREVENVAITALEGLKGDLAGRYYKLSEMTEQDQQRLIDDHFLFDK

• Applicable Applications for anti-CKMT2 antibody: Western Blot (WB)
• Application Notes: WB: 1:500-1:2000
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 40-230 of human CKMT2 (NP_001816.2).
• Cellular Location: Intermembrane side, Mitochondrion inner membrane, Peripheral membrane protein
• Positive Samples: Mouse skeletal muscle, Mouse heart, Rat skeletal muscle
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using CKMT2 antibody (A2206) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020).)

Related Product Information for anti-CKMT2 antibody

Background: Mitochondrial creatine kinase (MtCK) is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Sarcomeric mitochondrial creatine kinase has 80% homology with the coding exons of ubiquitous mitochondrial creatine kinase. This gene contains sequences homologous to several motifs that are shared among some nuclear genes encoding mitochondrial proteins and thus may be essential for the coordinated activation of these genes during mitochondrial biogenesis. Three transcript variants encoding the same protein have been found for this gene.

Product Categories/Family for anti-CKMT2 antibody

Endocrine & Metabolism; Mitochondrial metabolism; Mitochondrial markers

NCBI and Uniprot Product Information

• NCBI GI #: 153251984
• NCBI GeneID: 1160
• NCBI Accession #: NP_001093205.1
• NCBI GenBank Nucleotide #: NM_001099735.1
• UniProt Accession #: P17540; Q6ICS8; Q8N1E1
• Molecular Weight: 47,504 Da
• NCBI Official Full Name: creatine kinase S-type, mitochondrial
• NCBI Official Synonym Full Names: creatine kinase, mitochondrial 2 (sarcomeric)
• NCBI Official Symbol: CKMT2
• NCBI Official Synonym Symbols: SMTCK
• NCBI Protein Information: creatine kinase S-type, mitochondrial; S-MtCK; mib-CK; basic-type mitochondrial creatine kinase; sarcomeric mitochondrial creatine kinase
• UniProt Protein Name: Creatine kinase S-type, mitochondrial
• Protein Family: Creatine kinase
• UniProt Gene Name: CKMT2
• UniProt Synonym Gene Names: Mib-CK; S-MtCK
• UniProt Entry Name: KCRS_HUMAN

NCBI Description

Mitochondrial creatine kinase (MtCK) is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Sarcomeric mitochondrial creatine kinase has 80% homology with the coding exons of ubiquitous mitochondrial creatine kinase. This gene contains sequences homologous to several motifs that are shared among some nuclear genes encoding mitochondrial proteins and thus may be essential for the coordinated activation of these genes during mitochondrial biogenesis. Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

CKMT2: Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa. Belongs to the ATP:guanido phosphotransferase family.

Protein type: Amino Acid Metabolism - arginine and proline; Mitochondrial; Kinase, other; EC 2.7.3.2

Chromosomal Location of Human Ortholog: 5q13.3

Cellular Component: mitochondrion; mitochondrial inner membrane

Molecular Function: creatine kinase activity; ATP binding

Biological Process: muscle contraction; creatine metabolic process; phosphorylation