Cyclin-dependent kinase inhibitor 1 (cki-1) Recombinant Protein | cki-1 recombinant protein
Recombinant Caenorhabditis elegans Cyclin-dependent kinase inhibitor 1 (cki-1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cyclin-dependent kinase inhibitor 1 (cki-1); Recombinant Caenorhabditis elegans Cyclin-dependent kinase inhibitor 1 (cki-1); cki-1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-184, Full length
Sequence
MSSARRCLFGRPTPEQRSRTRIWLEDAVKRMRQEESQKWGFDFELETPLPSSAGFVYEVIPENCVPEFYRTKVLTVRTTCSSLDISSTTLTPLSSPSTSDKEEPSLMDPNSSFEDEEEPKKWQFREPPTPRKTPTKRQQKMTDFMAVSRKKNSLSPNKLSPVNVIFTPKSRRPTIRTRSSCSPY
Sequence Length
184
Species
Caenorhabditis elegans
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21,245 Da
NCBI Official Full Name
Cyclin-dependent kinase inhibitor 1
NCBI Official Symbol
cki-1
NCBI Protein Information
Cyclin-dependent kinase inhibitor 1
UniProt Protein Name
Cyclin-dependent kinase inhibitor 1
Protein Family
UniProt Gene Name
cki-1
Uniprot Description
Negative cell-cycle regulator that functions at the G1-to-S-phase transition. It is required for suspension of cell cycling in dauer larvae and starved L1 larvae. In vulval precursor cells (VPCs) a pathway of heterochronic genes acts via cki-1 to maintain VPC in G1 during L2 larval stage (PubMed:10587644, PubMed:9716524). Cul-2 may function in ubiquitin-mediated degradation by targeting cki-1 for degradation (PubMed:10587644). Involved in distal tip cell development by repressing and modulating cye-1/cdk-2 activity levels in Z1.aa/Z4.pp and in Z1.ap/Z4.pa (PubMed:17476329).
Research Articles on cki-1
Similar Products
Product Notes
The cki-1 cki-1 (Catalog #AAA1370131) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-184, Full length. The amino acid sequence is listed below: MSSARRCLFG RPTPEQRSRT RIWLEDAVKR MRQEESQKWG FDFELETPLP SSAGFVYEVI PENCVPEFYR TKVLTVRTTC SSLDISSTTL TPLSSPSTSD KEEPSLMDPN SSFEDEEEPK KWQFREPPTP RKTPTKRQQK MTDFMAVSRK KNSLSPNKLS PVNVIFTPKS RRPTIRTRSS CSPY. It is sometimes possible for the material contained within the vial of "Cyclin-dependent kinase inhibitor 1 (cki-1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
