Cold-inducible RNA-binding protein (CIRBP) Recombinant Protein | CIRBP recombinant protein
Recombinant Cricetulus griseus Cold-inducible RNA-binding protein (CIRBP)
Gene Names
Cirbp; CIRP; A18 hnRNP
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cold-inducible RNA-binding protein (CIRBP); Recombinant Cricetulus griseus Cold-inducible RNA-binding protein (CIRBP); CIRBP recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-172, full length protein
Sequence
MASDEGKLFVGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRSRGRGFSRGGGDRGYGGGRFESRSGGYGGSRDYYASRSQGGSYGYRSSGGSYRDSYDSYATHNE
Sequence Length
172
Species
Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18,607 Da
NCBI Official Full Name
cold-inducible RNA-binding protein
NCBI Official Symbol
Cirbp
NCBI Official Synonym Symbols
CIRP; A18 hnRNP
NCBI Protein Information
cold-inducible RNA-binding protein
UniProt Protein Name
Cold-inducible RNA-binding protein
Protein Family
UniProt Gene Name
CIRBP
UniProt Synonym Gene Names
CIRP
Uniprot Description
Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. Acts as a translational activator. Seems to play an essential role in cold-induced suppression of cell proliferation. Binds specifically to the 3'-untranslated regions (3'-UTRs) of stress-responsive transcripts RPA2 and TXN. Acts as a translational repressor. Promotes assembly of stress granules (SGs), when overexpressed ().
Similar Products
Product Notes
The CIRBP cirbp (Catalog #AAA1137284) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-172, full length protein. The amino acid sequence is listed below: MASDEGKLFV GGLSFDTNEQ ALEQVFSKYG QISEVVVVKD RETQRSRGFG FVTFENIDDA KDAMMAMNGK SVDGRQIRVD QAGKSSDNRS RGYRGGSAGG RGFFRGGRSR GRGFSRGGGD RGYGGGRFES RSGGYGGSRD YYASRSQGGS YGYRSSGGSY RDSYDSYATH NE. It is sometimes possible for the material contained within the vial of "Cold-inducible RNA-binding protein (CIRBP), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
