Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human Intestine)

Rabbit ATF2 Polyclonal Antibody | anti-ATF2 antibody

ATF2 antibody - C-terminal region

Gene Names
ATF2; HB16; CREB2; TREB7; CREB-2; CRE-BP1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
ATF2; Polyclonal Antibody; ATF2 antibody - C-terminal region; anti-ATF2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LRNEVAQLKQLLLAHKDCPVTAMQKKSGYHTADKDDSSEDISVPSSPHTE
Sequence Length
505
Applicable Applications for anti-ATF2 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ATF2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Intestine)

Immunohistochemistry (IHC) (Human Intestine)

Immunohistochemistry (IHC)

(Human kidney )

Immunohistochemistry (IHC) (Human kidney )

Immunohistochemistry (IHC)

(Rabbit Anti-ATF2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Ovary TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-ATF2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Ovary TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(Host: MouseTarget Name: ATF2Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: ATF2Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-ATF2 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-ATF2 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-ATF2 antibody
This is a rabbit polyclonal antibody against ATF2. It was validated on Western Blot and immunohistochemistry

Target Description: ATF2 encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds to the cAMP-responsive element (CRE), an octameric palindrome. The protein forms a homodimer or heterodimer with c-Jun and stimulates CRE-dependent transcription. The protein is also a histone acetyltransferase (HAT) that specifically acetylates histones H2B and H4 in vitro; thus it may represent a class of sequence-specific factors that activate transcription by direct effects on chromatin components.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
cyclic AMP-dependent transcription factor ATF-2 isoform 1
NCBI Official Synonym Full Names
activating transcription factor 2
NCBI Official Symbol
ATF2
NCBI Official Synonym Symbols
HB16; CREB2; TREB7; CREB-2; CRE-BP1
NCBI Protein Information
cyclic AMP-dependent transcription factor ATF-2
UniProt Protein Name
Cyclic AMP-dependent transcription factor ATF-2
UniProt Gene Name
ATF2
UniProt Synonym Gene Names
CREB2; CREBP1; cAMP-dependent transcription factor ATF-2; CREB-2
UniProt Entry Name
ATF2_HUMAN

NCBI Description

This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions This protein binds to the cAMP-responsive element (CRE), an octameric palindrome. It forms a homodimer or a heterodimer with c-Jun and stimulates CRE-dependent transcription. This protein is also a histone acetyltransferase (HAT) that specifically acetylates histones H2B and H4 in vitro; thus it may represent a class of sequence-specific factors that activate transcription by direct effects on chromatin components. The encoded protein may also be involved in cell's DNA damage response independent of its role in transcriptional regulation. Several alternatively spliced transcript variants have been found for this gene [provided by RefSeq, Jan 2014]

Uniprot Description

ATF-2: a transcription factor that is a member of the leucine zipper family. Binds to the cAMP-responsive element (CRE). Forms a homodimer or heterodimer with c-Jun and stimulates CRE-dependent transcription. Also possesses histone acetyltransferase (HAT) activity that specifically acetylates histones H2B and H4 in vitro.

Protein type: EC 2.3.1.48; Transcription factor; C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 2q32

Cellular Component: nucleoplasm; mitochondrial outer membrane; cytoplasm; nucleus

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; protein binding; histone acetyltransferase activity; protein heterodimerization activity; metal ion binding; transcription coactivator activity; cAMP response element binding protein binding; chromatin binding; transcription factor activity; protein kinase binding

Biological Process: fat cell differentiation; transcription from RNA polymerase II promoter; establishment and/or maintenance of chromatin architecture; MyD88-independent toll-like receptor signaling pathway; stress-activated MAPK cascade; toll-like receptor 3 signaling pathway; response to osmotic stress; positive regulation of transforming growth factor-beta2 production; toll-like receptor 2 signaling pathway; toll-like receptor 10 signaling pathway; toll-like receptor 5 signaling pathway; regulation of transcription from RNA polymerase II promoter; MyD88-dependent toll-like receptor signaling pathway; regulation of transcription, DNA-dependent; regulation of transcription factor activity; intra-S DNA damage checkpoint; toll-like receptor signaling pathway; innate immune response; positive regulation of transcription factor activity; positive regulation of transcription from RNA polymerase II promoter; toll-like receptor 9 signaling pathway; histone acetylation; toll-like receptor 4 signaling pathway; response to DNA damage stimulus

Research Articles on ATF2

Similar Products

Product Notes

The ATF2 atf2 (Catalog #AAA3201890) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATF2 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ATF2 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the ATF2 atf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LRNEVAQLKQ LLLAHKDCPV TAMQKKSGYH TADKDDSSED ISVPSSPHTE. It is sometimes possible for the material contained within the vial of "ATF2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.